CAZyme Information: MGYG000002490_01239

Basic Information

• Species: Paenibacillus_B thiaminolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B thiaminolyticus
• CAZyme ID: MGYG000002490_01239
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
269	MGYG000002490_14|CGC2	29772.34	11.9226

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002490	6537383	Isolate	Japan	Asia

• Gene Location: Start: 101947; End: 102756 Strand: -

Full Sequence      

MAHSKRFRSARTRTRRRVRRHRIHSSSDPFVSVIIPVLNERRTLARVIERAAQVHPASEV
IVVANGTTDGSDRIAEEMGARVLRYAIPLGHDKGRSIGAEAAAGRILLFIDGDIVLQASE
LRPFVHAVNNGVDVALNNYQGPVRKHTVHGVVLAKHALNAMLSRQDLGGASMTAVPHALS
RRALELIGVDALSVPPLAHTMAIVYGLNIRGVHTIDVGRINRIRVRGMGQDPLEPLIWQD
HMQAIRWLMEQRGPRGGHSDLTRQRERVT

Enzyme Prediction     

No EC number prediction in MGYG000002490_01239.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	32	136	2.2e-19	0.6588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0463	WcaA	6.49e-18	27	132	1	111	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
TIGR04283	glyco_like_mftF	2.40e-16	31	118	1	86	transferase 2, rSAM/selenodomain-associated. This enzyme may transfer a nucleotide, or it sugar moiety, as part of a biosynthetic pathway. Other proposed members of the pathway include another transferase (TIGR04282), a phosphoesterase, and a radical SAM enzyme (TIGR04167) whose C-terminal domain (pfam12345) frequently contains a selenocysteine. [Unknown function, Enzymes of unknown specificity]
pfam00535	Glycos_transf_2	3.75e-16	32	136	1	112	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	6.20e-16	33	135	1	111	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd02522	GT_2_like_a	1.16e-15	31	113	1	82	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM46166.1	1.98e-189	1	269	1	269
SYX82154.1	1.38e-112	5	268	9	275
AJS61351.1	4.24e-98	29	268	9	248
AZN43919.1	3.30e-97	26	266	14	255
AFH65125.1	5.58e-96	15	268	4	258

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GYG7	5.37e-09	25	140	2	126	Glycosyltransferase AglE OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglE PE=1 SV=1
A0A0H3M5A8	3.26e-08	31	190	612	783	Bifunctional apolipoprotein N-acyltransferase/polyprenol monophosphomannose synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lnt PE=1 SV=1
O53493	3.26e-08	31	190	612	783	Bifunctional apolipoprotein N-acyltransferase/polyprenol monophosphomannose synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ppm1 PE=1 SV=1
A0QZ12	9.48e-07	33	191	26	196	Polyprenol monophosphomannose synthase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=ppm1 PE=1 SV=1
P37786	1.62e-06	31	136	7	112	Protein RfbJ OS=Shigella flexneri OX=623 GN=rfbJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002490_01239.