CAZyme Information: MGYG000002490_03294

Basic Information

• Species: Paenibacillus_B thiaminolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B thiaminolyticus
• CAZyme ID: MGYG000002490_03294
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	MGYG000002490_30|CGC2	91599.86	6.3721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002490	6537383	Isolate	Japan	Asia

• Gene Location: Start: 59468; End: 61825 Strand: +

Full Sequence      

MPNAATNNNYEISMENIRSMPPTSYFGTKILFVISGSLTVNCTARDYKLQAHDILILNRN
DRHEIASQEDNIVIVLSLTAQFFAQHDKSYFSYHFDCFSREMDPGREQMVALLRRYVAEI
MIAYSRTGALPNLELQSSLFQMMLLLTRFFKTEAPVREGSSHDDERIMRIIQEIEQRYDE
PITLNEIAQKEYLSVSYLSRYFKKMTGFGFVQYVNLVRLKHSLDDLLHSTDSLSHIALKH
GFASSKHFNAVFKAAYGMSPAQYRKEHSEHQDDVQPAANHASEPRTVLQSPDILAKLAQY
IETGEQISDISEAVFENRQIELDPTRQEEVAASTHVLFIGQLKELLNENVKEQVLMAQQE
LRIRYIGIRNLIFGKTLLPEVETDELVATSTPFMNSDLALQFLQDHHLHLLIRIEYQEIS
SDENKYFELLDKFIRHSIQIFGRDTVAKWRFLYYEPHATIASPEELRRIYLRLQALVKSR
EERVQVGTYLPFSERTGTTTTQHDWQLSHGDVIDFIAYEANPNEVVDFDKSADDDFTETQ
DYILSATSKLKAYLRKHRMEKSLFLMSWNTLTGNTRYTNGTFFRGALVMRAVLDISREAD
AIGFWINTEQHEGERRARNISIDGLELFHFFNGKRPAYYAVMFKERLRGRIVAQGKDYVM
TEHADGYQLALLNCNNFNPRFSVEELFLRQRKKEMHIRLLGMKPGAYQIRKFQFDRDHGA
LYSEWGKFNSKHGVDQEIMNYVINRSTPSLKVIDEQMSADWSFYVYLDMNAIHFYEFRRM
FDDMN

Enzyme Prediction     

No EC number prediction in MGYG000002490_03294.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	421	727	1.7e-16	0.7192575406032483

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3664	XynB	3.17e-91	345	779	1	426	Beta-xylosidase [Carbohydrate transport and metabolism].
COG2207	AraC	1.05e-27	146	272	1	127	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	1.99e-24	181	264	1	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	1.04e-20	187	265	1	80	Helix-turn-helix domain.
COG4977	GlxA	1.58e-20	155	272	210	327	Transcriptional regulator GlxA family, contains an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOF64550.1	4.02e-276	10	778	7	777
QOF56795.1	4.02e-276	10	778	7	777
QPJ25835.1	5.70e-276	10	779	7	778
QOF62367.1	1.86e-274	10	778	7	777
QGF42946.1	2.64e-274	10	778	7	777

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OOU_A	6.59e-09	167	267	7	107	Thestructure of a protein with unkown function from Listeria innocua [Listeria innocua]
6SWI_A	2.74e-07	167	265	7	106	TheC-terminal domain of AraT, a response regulator from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1BL0_A	1.13e-06	167	264	13	110	MultipleAntibiotic Resistance Protein (Mara)DNA COMPLEX [Escherichia coli]
1XS9_A	1.20e-06	167	264	16	113	ChainA, Multiple antibiotic resistance protein marA [Escherichia coli]
1D5Y_A	4.96e-06	174	265	12	103	CrystalStructure Of The E. Coli Rob Transcription Factor In Complex With Dna [Escherichia coli],1D5Y_B Crystal Structure Of The E. Coli Rob Transcription Factor In Complex With Dna [Escherichia coli],1D5Y_C Crystal Structure Of The E. Coli Rob Transcription Factor In Complex With Dna [Escherichia coli],1D5Y_D Crystal Structure Of The E. Coli Rob Transcription Factor In Complex With Dna [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q936F1	5.49e-82	27	779	22	741	Uncharacterized HTH-type transcriptional regulator OS=Staphylococcus aureus OX=1280 PE=4 SV=2
Q7A882	1.06e-81	27	779	22	741	Uncharacterized HTH-type transcriptional regulator SA0097 OS=Staphylococcus aureus (strain N315) OX=158879 GN=SA0097 PE=4 SV=1
Q99XB1	1.06e-81	27	779	22	741	Uncharacterized HTH-type transcriptional regulator SAV0101 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=SAV0101 PE=4 SV=1
Q6GKK1	1.47e-81	27	779	22	741	Uncharacterized HTH-type transcriptional regulator SAR0107 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=SAR0107 PE=4 SV=1
Q6GD21	3.92e-81	27	779	22	741	Uncharacterized HTH-type transcriptional regulator SAS0078 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=SAS0078 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002490_03294.