CAZyme Information: MGYG000002490_05453

Basic Information

• Species: Paenibacillus_B thiaminolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B thiaminolyticus
• CAZyme ID: MGYG000002490_05453
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213		23347.75	10.3923

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002490	6537383	Isolate	Japan	Asia

• Gene Location: Start: 739788; End: 740429 Strand: +

Full Sequence      

MDFYLSDGSRRLLFPLNPQQVTAATAARMVTYQSIALGEFTIPRGTVPTRFNWEGIFPGE
ARKDSVTVKSWQSPQAIAGLLSGWRDKGQKLKLLITETPINHDVYIQTFDHTWLGGHGDA
QYSIELVQAKMIMVPEKGQKAKSSGTAASAGRAAPPPPATYTVKPGDTLWGIAKRFLGNG
ARHGDIYRIPDNKKQIGPDPNQIKPGQVLRLPV

Enzyme Prediction     

No EC number prediction in MGYG000002490_05453.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	2.59e-13	161	212	98	146	LysM domain/BON superfamily protein; Provisional
cd00118	LysM	3.80e-10	160	211	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
COG1652	XkdP	8.71e-10	160	212	212	262	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
pfam01476	LysM	6.43e-08	161	212	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	1.01e-07	160	211	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM43778.1	1.85e-157	1	213	1	213
ADQ06516.1	2.62e-65	1	211	1	217
CBL19584.1	3.05e-42	1	212	1	213
AYO30799.1	6.57e-32	1	212	1	214
AEE95790.1	7.92e-29	1	212	1	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FIM_A	1.00e-06	79	212	2	147	Thestructure of Kbp.K from E. coli [Escherichia coli],7PVC_A Chain A, Potassium binding protein Kbp [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45932	1.05e-17	2	212	7	218	Uncharacterized protein YqbP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbP PE=4 SV=1
P54335	1.08e-16	2	212	7	218	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2
P0ADE6	4.87e-06	79	212	2	147	Potassium binding protein Kbp OS=Escherichia coli (strain K12) OX=83333 GN=kbp PE=1 SV=2
P0ADE7	4.87e-06	79	212	2	147	Potassium binding protein Kbp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=kbp PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002490_05453.