CAZyme Information: MGYG000002491_01050

Basic Information

• Species: Kluyvera ascorbata_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata_B
• CAZyme ID: MGYG000002491_01050
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		38526.28	8.808

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002491	5264779	Isolate	Spain	Europe

• Gene Location: Start: 168049; End: 169071 Strand: +

Full Sequence      

MANTYLNAQEMIKESIIFDERETAEGTSPLPVAYGIDKNFLFGCGVSIASVLLHNRDSDF
IFHVFIDTVPEAEKQHFAQLAKDYKTCIQIHIVNCDRLKAFPTTKNWSVAMYFRFIIGDY
FIGQQPRVLYLDADIVCQGSIKPLATLLLGDSVAGVVPERDKKWWRSRSQSLECPAIENG
YFNSGVLLLNIPAWASESVSSKAMSLLSDKNVTRKLSFMDQDILNIILAGKVTFIEGKYN
TQFSLNYELKTAFVNPINDGTVLIHYVGPTKPWHNWANYPSATPFLKAKAASPWQSTPLL
KPNNANYARYCAKHNFKNNQPVAGVMNYIYYFYLRLVKSR

Enzyme Prediction     

No EC number prediction in MGYG000002491_01050.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	20	276	1.2e-54	0.9182879377431906

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15171	PRK15171	0.0	5	336	2	333	lipopolysaccharide 3-alpha-galactosyltransferase.
pfam01501	Glyco_transf_8	4.27e-79	31	277	1	252	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	4.43e-79	30	320	3	293	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd04194	GT8_A4GalT_like	5.65e-74	30	275	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam08437	Glyco_transf_8C	2.01e-18	280	333	1	54	Glycosyl transferase family 8 C-terminal. This domain is found at the C-terminus of the pfam01501 domain in bacterial glucosyltransferase and galactosyltransferase proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBR18703.1	2.59e-257	1	340	1	340
BBS89583.1	2.59e-257	1	340	1	340
BBT68894.1	2.59e-257	1	340	1	340
BBR56822.1	2.59e-257	1	340	1	340
ASG62468.1	4.79e-200	1	336	1	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1G9R_A	2.50e-19	32	274	3	253	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
1SS9_A	2.50e-19	30	274	1	253	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
5GVW_A	2.43e-13	106	277	75	239	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
6U4B_A	3.47e-13	28	295	300	589	ChainA, WbbM protein [Klebsiella pneumoniae]
5GVV_A	4.38e-13	106	277	75	239	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27128	7.98e-122	1	332	1	333	Lipopolysaccharide 1,3-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaI PE=3 SV=1
P19816	6.08e-116	9	338	8	337	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4
P19817	2.66e-65	12	298	9	295	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P27129	2.05e-58	30	295	28	294	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
A0A0H2URH2	5.02e-17	32	277	5	233	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002491_01050.