CAZyme Information: MGYG000002491_01338

Basic Information

• Species: Kluyvera ascorbata_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata_B
• CAZyme ID: MGYG000002491_01338
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673	MGYG000002491_4|CGC2	75169.24	8.7947

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002491	5264779	Isolate	Spain	Europe

• Gene Location: Start: 45325; End: 47346 Strand: -

Full Sequence      

MIGIYSSGIWQLPHLQRFLGEACCKLTPLSSLPGNVDAIAVWGERPSALRPIERAQKAGL
PVLRLEDGFTRSLELGVNGAPPLGIVVDDLGIYYDARRPSRLEILIKQEAETPTLKNEAL
RVTAFIVENDLSKYNHAPRFKETHHDNVTLVVDQTYGDVSVTLGGATERQFAAMLSCAKK
EHPHGEIWVKTHPDVLTGKKKGYFEALTADPRIRLITKDFSPQSLLRQVSHVYTVTSQYG
IEALMAGKKVTCFGLPWYAGWGLTDDRHPQSQDIAARRGNAPLSALVAAAWLQYTRYVDP
HTGEASTLPDVLEYLRLQRQHLLARSGQLWAPGMTLWKSSIVRPFLKTSGNSVDFSHKGK
EASACVVWGIKGEQRWRQKASQYDIPVWRMEDGFLRSSGLGSDLQPPLSLVLDKTGIYYD
ASRPSDLENLLIHSDLVPEQQRRAESLRQKLIANKLSKYNLGASWQIPAGAAGKRRLLVT
GQVENDASIASGTATIRTNLSLLSTVRARHPDAFIIYKPHPDVLVGNRPGHIPDEEMHRL
ADCVALDADIIECIQQVDEVHTMTSLSGFEALMHGKAVYCYGMPFYAGWGLTTDEYACER
RQRLLTISDLLYQTLIGYPAYIHPESKQCISPEMAMDWLLAQKRQAMGIKRGAGQYLQRQ
GRKLHMLMKTMKN

Enzyme Prediction     

No EC number prediction in MGYG000002491_01338.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	277	669	5.8e-146	0.7443609022556391
GT107	10	321	3.1e-101	0.5921052631578947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	4	645	6	645	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16439	beta_Kdo_transferase_KpsC_2	5.32e-157	366	621	4	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16440	beta_Kdo_transferase_KpsC_1	1.87e-137	39	300	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	1.89e-123	365	621	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	1.54e-103	39	297	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBQ85597.1	0.0	1	673	1	673
BBR22595.1	0.0	1	673	1	673
BBS98391.1	0.0	1	673	1	673
BBR60671.1	0.0	1	673	1	673
BBT72535.1	0.0	1	673	1	673

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGC_A	3.82e-150	2	348	3	351	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGB_A	5.26e-74	2	315	11	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	9.76e-63	335	644	10	323	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42217	1.71e-304	1	670	1	672	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
Q05013	1.44e-191	4	643	26	675	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P57037	3.26e-190	4	643	26	675	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
P31858	3.14e-52	348	621	105	381	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002491_01338.