CAZyme Information: MGYG000002491_02767

Basic Information

• Species: Kluyvera ascorbata_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata_B
• CAZyme ID: MGYG000002491_02767
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000002491_10|CGC5	43684.74	5.8376

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002491	5264779	Isolate	Spain	Europe

• Gene Location: Start: 111798; End: 112937 Strand: -

Full Sequence      

MKVWPVKHSPLLRQPEHFISREELKALIQTVTNNLVNIKDETGQFLLRLDDGRVIDTKGW
AGWEWTHGVGLYGIYQYYQQTGDVAMRDIIDSWFADRFAEGATTKNVNTMAPFLTLAYRY
EETGNPAYLPWLDSWAEWAMHEMPRTDYGGMQHITLAEENHQQMWDDTLMMTVLPLAKIG
KLLNRPEYVEEAVYQFLLHVQNLMDRETGLWFHGWNYDGHHNFAHARWARGNSWLTIVIP
DFLELVDLPENNATRRYLVQVLNAQIAALAKCQHESGLWHTLLDDPHSYLEASATAGFAY
GILKAVRKRYVGQEYAEVAEKAMKGIVKHVSPEGELLQTSFGTGMGSNLDFYREIPLTSM
PYGQAMAILCLTEYLRKFF

Enzyme Prediction     

No EC number prediction in MGYG000002491_02767.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	60	376	2.6e-117	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	6.89e-144	29	379	2	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	5.91e-130	37	376	1	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBS96311.1	4.06e-292	1	379	1	379
BBT70641.1	4.06e-292	1	379	1	379
BBR59370.1	4.06e-292	1	379	1	379
BBQ83360.1	4.06e-292	1	379	1	379
BBR20455.1	4.06e-292	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	9.69e-254	3	379	5	381	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.59e-250	2	379	5	382	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	8.08e-160	23	378	7	372	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	4.23e-18	187	357	224	392	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.13e-52	63	376	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	4.05e-11	180	322	10	158	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.05e-11	180	322	10	158	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002491_02767.