CAZyme Information: MGYG000002491_03177

Basic Information

• Species: Kluyvera ascorbata_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata_B
• CAZyme ID: MGYG000002491_03177
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500	MGYG000002491_13|CGC2	56269.02	9.9236

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002491	5264779	Isolate	Spain	Europe

• Gene Location: Start: 57136; End: 58638 Strand: +

Full Sequence      

MNAMPFYRLITASFSALLLICAVAQAEEKTDALEINIDSVMQPWRGDLPGMLDRRVIRVL
TTYSKTFFFIDKGQQRGATHDIFAEFEKALNARLAKEKKLQQRHLKVRIIFVPVTRDNLL
SALNAGKGDIAAANLTITPSRQQAVAFTDPIYNNIQELLISGPASPTVKNIDDLSGKTVF
VRRSSSYYESLVALNARFASASRPPVIIQPAPEALEDEDLLEMLSAGLIPLIIVDRHKAL
FWKQVFPKIQVHEDIVLRENGSIAWAVRQDEPQLLAALNGFIKDNRQGSTLGNTLLLRYL
KNAKYVKNAAAEKERRKFLTMVEIFRKYGDRYDVDWLLMAAQGYQESRLNQSVRSHVGAI
GVMQVMPGTGKALKVGDIKQLDPNIHAGVKYMRWMIDHYYGDEPMTQLDKALFSFAAYNA
GPARIARLRQETAKRGFDPNVWFGNVENLAAEKIGAETVTYVSNIYKYFIAYRLILDEMN
RKRAAMGKPPILPATDKNNG

Enzyme Prediction     

No EC number prediction in MGYG000002491_03177.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	334	469	1.4e-22	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01009	PBP2_YfhD_N	1.06e-76	55	301	1	223	The solute binding domain of YfhD proteins, a member of the type 2 periplasmic binding fold protein superfamily. This subfamily includes the solute binding domain YfhD_N. These domains are found in the YfhD proteins that are predicted to function as lytic transglycosylases that cleave the glycosidic bond between N-acetylmuramic acid and N-acetylglucosamin in peptidoglycan, while the YfhD_N domain might act as an auxiliary or regulatory subunit. In addition to periplasmic solute binding domain, they have an SLT domain, typically found in soluble lytic transglycosylases, and a C-terminal low complexity domain. The YfhD proteins might have been recruited to create localized cell wall openings required for transport of large substrates such as DNA. They belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.
cd13403	MLTF-like	1.20e-68	325	473	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	4.04e-64	42	473	6	432	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	5.82e-58	6	468	5	446	membrane-bound lytic murein transglycosylase MltF.
cd13530	PBP2_peptides_like	1.07e-29	56	291	1	210	Peptide-binding protein and related homologs; type 2 periplasmic binding protein fold. This domain is found in solute binding proteins that serve as initial receptors in the ABC transport, signal transduction and channel gating. The PBP2 proteins share the same architecture as periplasmic binding proteins type 1, but have a different topology. They are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the family includes ionotropic glutamate receptors and unorthodox sensor proteins involved in signal transduction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBR22920.1	0.0	1	500	1	500
BBR60942.1	0.0	1	500	1	500
BBS93652.1	0.0	1	500	1	500
QIR29289.1	0.0	1	500	1	503
QGH31835.1	4.57e-296	1	499	9	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	3.02e-28	56	469	12	418	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	3.30e-28	56	469	19	425	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OYV_A	4.48e-28	56	469	19	425	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
5AA2_B	4.71e-28	56	469	53	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	5.39e-28	56	469	5	411	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3KHL5	3.16e-31	47	469	29	448	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=mltF PE=3 SV=1
A8ZWR8	1.01e-30	57	469	43	445	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q4KHS7	2.02e-30	49	469	31	448	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=mltF PE=3 SV=2
A4VP14	2.75e-30	47	469	33	448	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=mltF PE=3 SV=2
A4XXV1	2.41e-29	57	469	45	450	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas mendocina (strain ymp) OX=399739 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001705	0.997210	0.000354	0.000268	0.000225	0.000222

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002491_03177.