CAZyme Information: MGYG000002491_03552

Basic Information

• Species: Kluyvera ascorbata_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata_B
• CAZyme ID: MGYG000002491_03552
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	MGYG000002491_16|CGC1	86221.91	5.6127

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002491	5264779	Isolate	Spain	Europe

• Gene Location: Start: 92307; End: 94679 Strand: -

Full Sequence      

MTPIYKDPQRPIKERVADLLARMTPEEKYAQMHAWWLVLSPDGNHRERTDMSDEFAGVSE
QTALSERLKLGVGQITRPLGTHIVDARTGVRAANRLQKMLMEETRLGIPALFHEECLVGL
LCKDATLFPSSLNYGSTWDPELVKRAAQQIGEEARSTGCKQGLAPVLDVSRDVRWGRTEE
TFGEDPWLVGVMACAYVEGLQGEKRDVLATLKHYVGHSFSEGARNHAPVHLGFRELNDTF
LLPFEMAVKRANAGSVMPAYHDIDNQPGHSDRFLLTTVLRERWGFDGIVVADYGGVSLLH
QHHGVSHDPAESAALAFNAGLDVELPKDDCARHLAEAVARGLITPEKIDEIVARTLTEKF
RLGLFEHPYTDEHAISLQSATTRQVAREVATRSMTLLENRDALPLSGQQTVAVVGPTADD
PLALLSGYSFPVHLIISDMVEKTSQVTTPLVALRDYLGADRVRYAKGCHIIEQRMAGAPV
FPGDSSGKPMQSSPVSQDLSLIADAVRAAQESDVVVACVGDLAGLFQSGTVGEGSDTDSL
NLPGVQQQLLQALVDTGKPVVVVMTGGRPYSLQGLESKVAALMLAWAPGQEGGWAIADAL
TGRVEPQGRLVVSVPKSAGAMPFYYNHKLKSGGTPFAFHFGARYPFGYGKGWGDFQFGTP
ELAESQVAIDGEIALRVTVTNRADRRGSEVVQLYVRDKVASLVRPLQELKAFQRVTLAPG
EQATLTFTLPVDMLNFTSYEGQRIVEPGEFELQVGRSSADIQGRVTVSVIGQTRVLSSDW
EMMSRCEVGY

Enzyme Prediction     

EC	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	102	326	7.4e-66	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.05e-160	16	762	38	758	beta-glucosidase BglX.
COG1472	BglX	3.80e-84	23	421	1	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	6.44e-76	68	357	28	315	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	1.26e-58	105	769	78	779	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	4.12e-52	394	652	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBR21017.1	0.0	1	790	1	790
BBS91951.1	0.0	1	790	1	790
BBR58755.1	0.0	1	790	1	790
BBQ84063.1	0.0	1	790	1	790
QIR27263.1	0.0	1	789	1	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	2.29e-125	91	762	106	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	5.31e-123	89	762	65	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	1.19e-122	3	769	5	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5XXN_A	2.89e-122	89	762	65	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
7EAP_A	9.09e-122	3	769	5	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	2.48e-116	16	762	38	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	2.47e-115	105	769	62	722	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	2.79e-114	16	762	38	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	3.23e-107	5	760	29	746	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.63e-76	12	761	35	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002491_03552.