CAZyme Information: MGYG000002491_04300

Basic Information

• Species: Kluyvera ascorbata_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata_B
• CAZyme ID: MGYG000002491_04300
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		40299.11	4.7328

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002491	5264779	Isolate	Spain	Europe

• Gene Location: Start: 32681; End: 33757 Strand: -

Full Sequence      

MNNAALNGLLEQVVQGFCRLKNMGEVGTRDGEGFAIHFEEWEWEVGVGLYGFWQYARQQN
DARLQQSILTWYEDQLAKGLPEIQINTTAPMITLALVAGHTGRDDLLTVVNDWADALLRT
LPKTEEGGFQHVVKEQPNTGHLWDDTLFMTCLFLGTAGVVLKRKDLIDEASYQFLLHTRY
LCEPASGLWYHGWTFVGKHHFSEAFWGRGNAWITVAIPEFIALLGDSLDASVKRYLAVVV
ARQVNTLCELQADNGMWHTLLDDPLSPQESSATAGIAYGMLRGVRMGILDEKVADHAMRA
WYALRDRIDDGILLEASKGTMVGPDLQYYCDIAMAPVPYAQALMMLLLLELQQEKWCR

Enzyme Prediction     

No EC number prediction in MGYG000002491_04300.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	38	352	1.2e-90	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	8.14e-88	40	339	33	337	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.34e-73	40	304	26	288	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBQ85676.1	2.98e-272	1	358	1	358
BBR22673.1	2.98e-272	1	358	1	358
BBS93439.1	1.73e-271	1	358	1	358
BBR60739.1	1.73e-271	1	358	1	358
BBT72749.1	1.73e-271	1	358	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	3.07e-84	6	350	27	376	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	4.23e-81	6	350	26	375	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	1.33e-77	38	350	44	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	1.99e-10	122	333	110	320	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.53e-37	41	329	29	312	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	3.04e-10	143	311	201	373	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
P0A3U6	5.02e-08	158	300	10	158	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	5.02e-08	158	300	10	158	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002491_04300.