CAZyme Information: MGYG000002492_00050

Basic Information

• Species: Agathobacter rectalis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter rectalis
• CAZyme ID: MGYG000002492_00050
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000002492_1|CGC2	38848.31	9.4319

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002492	3449685	Isolate	not provided	not provided

• Gene Location: Start: 58753; End: 59829 Strand: -

Full Sequence      

MKKIVMTGGGTAGHVTPNIALMPALKEAGYDIEYIGSVNGMEKGLIEAQKIPYHGISSGK
LRRYFDWKNFTDPFRVLKGYGQAVSLMKKIKPDVVFSKGGFVSVPVVLAAKHCHVPAIIH
ESDITPGLANKIAIKGAKKVCCNFPETMKYLPADKAVLTGSPIRRELFSGVAENAIKLCN
FPDHNKPVILIIGGSLGSKKVNEAVREILPELLKDFYVIHLCGKGNLDNKLAGITGYAQF
EYANAELTDMFALADMAISRAGANSICELLALHKPNILIPLSAAASRGDQVLNAKSFKKQ
GFSYVIEEEELTKDSLLSAVKEVYGNRDKYKDAMAKSGQMDSIATIIDLINSQVKKSS

Enzyme Prediction     

No EC number prediction in MGYG000002492_00050.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	189	339	4.6e-40	0.9490445859872612

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	3.21e-153	1	351	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	1.51e-144	1	356	1	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.79e-123	3	349	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	2.73e-109	2	356	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	1.13e-97	2	350	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR73859.1	1.91e-259	1	358	1	358
CBK91832.1	3.85e-259	1	358	1	358
CBK92342.1	3.85e-259	1	358	1	358
VCV23957.1	2.79e-182	1	356	9	364
CBL13543.1	2.79e-182	1	356	9	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	3.01e-39	2	350	10	362	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	2.32e-34	4	323	5	321	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	8.50e-34	2	320	7	319	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4Z1B5	1.14e-163	1	355	1	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=murG PE=3 SV=1
A9KK83	1.42e-157	1	350	1	349	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=murG PE=3 SV=1
Q0TNP7	6.17e-145	3	350	5	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=murG PE=3 SV=2
Q8XIQ1	6.17e-145	3	350	5	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=murG PE=3 SV=1
A4IJS4	8.46e-145	2	355	3	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002492_00050.