CAZyme Information: MGYG000002492_02501

Basic Information

• Species: Agathobacter rectalis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter rectalis
• CAZyme ID: MGYG000002492_02501
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
794		87918.18	8.8831

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002492	3449685	Isolate	not provided	not provided

• Gene Location: Start: 2620463; End: 2622847 Strand: -

Full Sequence      

MKSELKSKIIIIFLIIFATIGGYNSLIYADEQKKSYEYDMYENGSGKDITSDEAVKSEGD
NLKESDGTDLFRTSNMGISQSGVDLIKQFEGCRLTAYKVTSSEKYYTIGYGHYGSDVYAG
MTITQAQAESMLKSDLVRFEGYVNTFLNKYNITINQNQFDALVSFTYNVGNVWVSYNTFQ
LKTYLINGVSNYNSDQITTAFTNWNKSGGVVLDGLTRRRKAEAALFLNGNTNDCSCSDSY
AGDYVCTASSALNIRSGHGGTVIGTIPSGAVVYVSKGDGTWAHVSYNGINGCSSMQYLKK
KQDTLNYQLHVWISDTDMGSVPEHFYKGKSYYLCYEILDMDTGKRVDIDHDGLNYSVSEV
FGYPDGTKSDPCTYGNDYNWYRSYMGATGQYKGIVTVTGDINTSCEIGWKVEYSGNVTLK
ASTYSVNLNIPGNISQRVTLTMEGEIPDNCALSKDSSGNGFSAKWDGDWNGWSHDMVITG
EGSGSGVIIVSVVDGKNASVKYGTIKIYVNVTKEQKTVSAMSGVKLAGRADDALRINWNI
NSSASGYIIEQYKNGNWSRIARIADKNTKTYRIEKLTNSTDYRFRIQGFNFDNGTPVYGS
YTYVSGKTNPSKITGVTIGGRAVDALRLNWNKVSGASGYIIEKYENGKWNRIARIADVKT
RTYRVEGLKASTTYKFRIKAFGFSGSTPLYSTYTYINGRTTPMAVTGVCIGGTAKDALRV
NWNKVSGASGYIIEKYENGNWNRVARIADGNTKTYRVEKLKKNTAYVFRIRAFDFDGNTP
LYSDSKYVNGSTNR

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	78	222	1.6e-38	0.9927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	5.77e-54	82	227	1	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	3.80e-29	76	229	5	150	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16901	lyz_P1	3.79e-25	78	225	2	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16900	endolysin_R21-like	1.39e-21	85	227	11	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00959	Phage_lysozyme	2.95e-17	105	220	1	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR76485.1	0.0	1	794	1	794
CBK95964.1	1.68e-41	518	784	254	521
CBL34359.1	2.87e-39	518	783	490	756
QKS43439.1	9.75e-38	78	233	5	145
QKS48534.1	1.33e-37	78	233	5	145

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	3.06e-19	79	227	53	194	ChainA, Lysozyme [Acinetobacter baumannii]
7M5I_A	1.55e-14	70	228	1	155	ChainA, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]
2ANV_A	4.50e-13	76	228	2	146	ChainA, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]
6H9D_A	1.06e-11	78	227	6	147	ChainA, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q37896	2.54e-32	76	235	1	151	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
P07540	1.04e-31	76	235	1	151	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
P11187	1.42e-31	76	235	1	151	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
P62693	3.48e-26	76	232	1	145	Endolysin OS=Lactococcus phage phivML3 OX=10746 GN=L3 PE=3 SV=1
P62692	3.48e-26	76	232	1	145	Endolysin OS=Lactococcus phage c2 OX=31537 GN=L3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.640152	0.330649	0.025699	0.000905	0.000541	0.002055

TMHMM  Annotations     

start	end
7	29