CAZyme Information: MGYG000002493_00981

Basic Information

• Species: Enterococcus_B pernyi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B pernyi
• CAZyme ID: MGYG000002493_00981
• CAZy Family: GH73
• CAZyme Description: Autolysin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289		31713.16	6.4899

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002493	3324684	Isolate	Chile	South America

• Gene Location: Start: 289232; End: 290101 Strand: -

Full Sequence      

MQELRTRSARHHRPKRKMTINKKAIAPLVGTSLLVGPMLVTATPQTVRADELDVASSADP
QAFINQIGWAASEVAASNDLYASVMIAQALLESAYGTSGLSSAPYYNLFGVKGSAGQSVV
YMNTQEYLNGQWVTMNEPFRRYSSYWESFQDHANVLRSTSFSTGDYHYSGVWKSNTTSYY
DATAYLTGRYATDPNYAYKLNELISTYNLTRFDTPSTGSTTTSTTSTTTTSTTTSTTTTT
SSNQTYTVVSGDTLWDIAQKFGMSVDDLMAKNGMTMSNYSLLVGQEINV

Enzyme Prediction     

EC	3.2.1.-	3.2.1.17	3.2.1.96

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	70	209	5.4e-27	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	1.72e-62	14	289	101	374	1,4-beta-N-acetylmuramoylhydrolase.
COG1705	FlgJ	3.92e-62	21	213	1	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	1.24e-49	49	213	309	472	amidase domain-containing protein.
smart00047	LYZ2	2.29e-35	53	213	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	6.01e-21	70	152	3	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB52535.1	8.84e-187	1	289	1	289
BBM16136.1	8.84e-187	1	289	1	289
QCJ56280.1	8.84e-187	1	289	1	289
AZP92743.1	8.84e-187	1	289	1	289
BAO06833.1	8.84e-187	1	289	1	289

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	8.32e-37	61	213	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	2.23e-30	51	213	51	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	3.07e-13	61	205	2	144	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	3.68e-13	61	205	3	145	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	2.50e-12	61	205	3	145	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	4.21e-66	60	289	180	404	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	1.58e-62	23	289	22	298	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q9CIT4	3.46e-59	20	287	13	282	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	9.19e-59	22	287	18	284	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	1.29e-58	23	287	25	284	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003309	0.995475	0.000286	0.000459	0.000253	0.000222

TMHMM  Annotations     

start	end
25	47