CAZyme Information: MGYG000002493_01174

Basic Information

• Species: Enterococcus_B pernyi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B pernyi
• CAZyme ID: MGYG000002493_01174
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586	MGYG000002493_4|CGC5	64051.44	4.4115

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002493	3324684	Isolate	Chile	South America

• Gene Location: Start: 196293; End: 198053 Strand: +

Full Sequence      

MKRNVRLKKLLAGAALCSLLVVPLFLNEQQSAATEQTIKTTPDFGVGQGIEWPEQVVAPF
VDMTAYTSGTELSNNGALNLAAIAKETGKKFFNLGFMQAKGIKDGKIDWAWGGFAGLSEN
DSDQWQYEGIKKTIRELRVVGGDAAVSFGGLNTGAFWEVSHDEDMLYDAYMEVVQGYGFT
RVDFDVEAGAMGYTENLLNAKAVKRLQDTTGVQVTLTLPVMPTGLISTGLSVLQAYLEAG
VDLTNVNIMTMCYGPSVIDYAQGSLDAVDNTMVQLKNHYRQYAGITLTDEEAYAKLGTTP
SIGFENEQHPYFTTEMFNQVVEHARERKIGMVSYWSMNRNAKTDGGQGQIKNQFEFLKVS
EVFAEGNEGGGSETPEDKEKPSVPTNLSVGDITKNSAHINWTATDNDRVAKYNVRLVGNG
QTINVTTTSLSYAFANLKADTEYMVEINAEDRSGNISDTAKVAFTTLADVVDPEEPGEPG
EPGEAPAWEATKVYLGGEVVSYKGALYRAKHWTQNNVPSESGQYGPWELISGTPEGGDEI
AAWEANKVYVQGNRVTYNGIVYEAQYWTQNNKPSEAGLYGPWKQVG

Enzyme Prediction     

No EC number prediction in MGYG000002493_01174.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06543	GH18_PF-ChiA-like	3.04e-74	55	364	1	294	PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain. Members of this domain family are found not only in archaea but also in eukaryotes and prokaryotes. PF-ChiA exhibits hydrolytic activity toward both colloidal and crystalline (beta/alpha) chitins at high temperature.
COG3979	COG3979	1.61e-15	488	584	43	148	Chitodextrinase [Carbohydrate transport and metabolism].
cd12215	ChiC_BD	4.75e-14	541	584	1	42	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.
cd12215	ChiC_BD	1.52e-12	488	529	3	42	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.
smart00495	ChtBD3	2.93e-10	541	582	2	41	Chitin-binding domain type 3.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBM15772.1	0.0	1	586	1	587
QCJ55913.1	0.0	1	586	1	587
BAO06495.1	0.0	1	586	1	587
AUB52141.1	0.0	1	586	1	584
AUB52145.1	5.78e-285	7	531	6	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2DSK_A	9.14e-25	53	385	8	311	Crystalstructure of catalytic domain of hyperthermophilic chitinase from Pyrococcus furiosus [Pyrococcus furiosus],2DSK_B Crystal structure of catalytic domain of hyperthermophilic chitinase from Pyrococcus furiosus [Pyrococcus furiosus]
3A4W_A	5.68e-24	53	385	8	311	Crystalstructures of catalytic site mutants of active domain 2 of thermostable chitinase from Pyrococcus furiosus complexed with chito-oligosaccharides [Pyrococcus furiosus],3A4W_B Crystal structures of catalytic site mutants of active domain 2 of thermostable chitinase from Pyrococcus furiosus complexed with chito-oligosaccharides [Pyrococcus furiosus]
3A4X_A	1.04e-23	53	385	8	311	Crystalstructures of catalytic site mutants of active domain 2 of thermostable chitinase from Pyrococcus furiosus complexed with chito-oligosaccharides [Pyrococcus furiosus],3A4X_B Crystal structures of catalytic site mutants of active domain 2 of thermostable chitinase from Pyrococcus furiosus complexed with chito-oligosaccharides [Pyrococcus furiosus],3AFB_A Crystal structures of catalytic site mutants of active domain 2 of chitinase from Pyrococcus furiosus [Pyrococcus furiosus],3AFB_B Crystal structures of catalytic site mutants of active domain 2 of chitinase from Pyrococcus furiosus [Pyrococcus furiosus]
6Z40_A	3.83e-08	540	586	7	54	ChainA, Carbohydrate binding protein, putative, cpb33A [Cellvibrio japonicus Ueda107]
4TXG_A	3.49e-07	486	534	53	104	CrystalStructure of a Family GH18 Chitinase from Chromobacterium violaceum [Chromobacterium violaceum ATCC 12472]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13656	8.47e-26	52	364	584	892	Probable bifunctional chitinase/lysozyme OS=Escherichia coli (strain K12) OX=83333 GN=chiA PE=1 SV=2
O74199	1.00e-22	52	340	233	509	Endochitinase 11 OS=Metarhizium anisopliae OX=5530 GN=chi11 PE=1 SV=1
P14529	4.45e-15	83	359	60	320	Chitinase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=chiA2 PE=1 SV=2
P20533	8.69e-11	377	519	556	694	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P06566	1.48e-10	486	585	358	487	Endoglucanase A OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000343	0.998733	0.000350	0.000202	0.000174	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002493_01174.