CAZyme Information: MGYG000002493_01177

Basic Information

• Species: Enterococcus_B pernyi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B pernyi
• CAZyme ID: MGYG000002493_01177
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
192	MGYG000002493_4|CGC5	21340.07	8.3565

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002493	3324684	Isolate	Chile	South America

• Gene Location: Start: 200869; End: 201447 Strand: +

Full Sequence      

MKKFSVMMFVGIVMLGLFGFGTSGYAHGYVTSPGSRAYFGTAAAGNLNQNVGRAQWEPQS
IEAPKNTFIDGKIASAGVSGFEPLDEQTANRWHKSVINAGPLNITWNLTAQHRTSTWDYY
ITKPGWNQNQPLKFSDFELITKIDDKETVPPKTVNQTITVPQDRKGYNVILAVWNISDTT
NAFYQVIDVNVQ

Enzyme Prediction     

EC	1.-.-.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	27	190	1.3e-50	0.9943820224719101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	4.82e-69	1	190	1	192	N-acetylglucosamine-binding protein GbpA.
COG3397	COG3397	1.97e-66	1	191	1	207	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
cd21177	LPMO_AA10	4.34e-64	27	190	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
pfam03067	LPMO_10	1.43e-55	27	189	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
cd21174	LPMO_auxiliary	0.002	87	188	35	136	lytic polysaccharide monooxygenase auxiliary activity protein. Many proteins in this superfamily are copper-dependent lytic polysaccharide monooxygenases (LPMOs) and include lytic polysaccharide monooxygenase auxiliary activity families 9 (AA9) and 10 (AA10). The substrate-binding surface of this family is a flat beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB52146.1	3.64e-140	1	192	1	192
AZP92441.1	3.50e-138	1	192	1	192
VEF85652.1	3.20e-125	1	192	1	192
QTF90404.1	9.17e-125	1	192	1	192
AOM23146.1	9.17e-125	1	192	1	192

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4A02_A	4.55e-93	27	192	1	166	X-raycrystallographic structure of EfCBM33A [Enterococcus faecalis],4ALC_A X-Ray photoreduction of Polysaccharide monooxigenase CBM33 [Enterococcus faecalis],4ALE_A Structure changes of Polysaccharide monooxygenase CBM33A from Enterococcus faecalis by X-ray induced photoreduction. [Enterococcus faecalis],4ALQ_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis V583],4ALR_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis],4ALS_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis],4ALT_A X-Ray photoreduction of Polysaccharide monooxygenase CBM33 [Enterococcus faecalis]
5L2V_A	1.24e-52	27	191	1	164	Catalyticdomain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S],5L2V_B Catalytic domain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S]
5LW4_A	2.79e-50	27	190	1	168	NMRsolution structure of the apo-form of the chitin-active lytic polysaccharide monooxygenase BlLPMO10A [Bacillus licheniformis],6TWE_A Cu(I) NMR solution structure of the chitin-active lytic polysaccharide monooxygenase BlLPMO10A [Bacillus licheniformis DSM 13 = ATCC 14580]
2BEM_A	1.39e-47	27	190	1	167	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
2BEN_A	7.93e-47	27	190	1	167	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q838S1	1.59e-92	26	192	28	194	Lytic chitin monooxygenase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0362 PE=1 SV=1
Q8EHY2	2.35e-48	26	190	27	194	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
C3LW75	1.03e-40	1	189	1	199	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain M66-2) OX=579112 GN=gbpA PE=3 SV=1
Q6LKG5	2.93e-40	13	189	13	200	GlcNAc-binding protein A OS=Photobacterium profundum (strain SS9) OX=298386 GN=gbpA PE=3 SV=1
Q9KLD5	5.45e-40	1	189	1	199	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=gbpA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000955	0.998128	0.000355	0.000194	0.000171	0.000169

TMHMM  Annotations     

start	end
7	29