CAZyme Information: MGYG000002493_01606

Basic Information

• Species: Enterococcus_B pernyi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B pernyi
• CAZyme ID: MGYG000002493_01606
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213	MGYG000002493_6|CGC2	22925.46	4.8037

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002493	3324684	Isolate	Chile	South America

• Gene Location: Start: 168828; End: 169469 Strand: -

Full Sequence      

MKKSTLIGLGFILAGIGASTLTSVDVAAHGYVSEPASRGYQGSLDKNTNWNAAFKKYGAV
INEPQSLEAPKGFPAAGPEDGQIASANGAVGDFLLDQQTASLWTKQQLTAGANDFTWTFT
ANHATTKWHYYMTKAGWDKNDALTRDDLEFIGEVGNDGQLASTNPTHSINIPNDRLGYHV
ILAVWDVADTKNGFYNVIDVDVKGETVLADLQK

Enzyme Prediction     

EC	1.-.-.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	29	201	5.1e-51	0.9943820224719101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3397	COG3397	7.97e-77	1	211	1	216	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
PRK13211	PRK13211	8.86e-71	1	204	1	195	N-acetylglucosamine-binding protein GbpA.
pfam03067	LPMO_10	5.67e-60	29	200	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
cd21177	LPMO_AA10	1.26e-58	29	201	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
cd21174	LPMO_auxiliary	1.03e-06	70	199	18	136	lytic polysaccharide monooxygenase auxiliary activity protein. Many proteins in this superfamily are copper-dependent lytic polysaccharide monooxygenases (LPMOs) and include lytic polysaccharide monooxygenase auxiliary activity families 9 (AA9) and 10 (AA10). The substrate-binding surface of this family is a flat beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAO06199.1	1.25e-155	1	213	1	213
BBM15479.1	1.25e-155	1	213	1	213
AUB51874.1	3.44e-153	1	213	1	213
AZP92240.1	2.83e-152	1	213	1	213
QZY25858.1	1.50e-113	1	212	1	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YOX_A	1.24e-77	29	202	1	177	Bacillusamyloliquefaciens CBM33 in complex with Cu(I) after photoreduction [Bacillus amyloliquefaciens],2YOX_B Bacillus amyloliquefaciens CBM33 in complex with Cu(I) after photoreduction [Bacillus amyloliquefaciens],2YOY_A Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate [Bacillus amyloliquefaciens],2YOY_B Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate [Bacillus amyloliquefaciens]
2YOW_A	1.29e-77	29	202	1	177	Bacillusamyloliquefaciens CBM33 [Bacillus amyloliquefaciens],2YOW_B Bacillus amyloliquefaciens CBM33 [Bacillus amyloliquefaciens],5IJU_A Structure of an AA10 Lytic Polysaccharide Monooxygenase from Bacillus amyloliquefaciens with Cu(II) bound [Bacillus amyloliquefaciens],5IJU_B Structure of an AA10 Lytic Polysaccharide Monooxygenase from Bacillus amyloliquefaciens with Cu(II) bound [Bacillus amyloliquefaciens]
5LW4_A	2.07e-60	29	202	1	169	NMRsolution structure of the apo-form of the chitin-active lytic polysaccharide monooxygenase BlLPMO10A [Bacillus licheniformis],6TWE_A Cu(I) NMR solution structure of the chitin-active lytic polysaccharide monooxygenase BlLPMO10A [Bacillus licheniformis DSM 13 = ATCC 14580]
2BEN_A	5.90e-52	29	202	1	168	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
2BEM_A	5.90e-52	29	202	1	168	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8EHY2	6.91e-48	1	208	1	201	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q87FT0	2.87e-42	13	205	9	204	GlcNAc-binding protein A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=gbpA PE=3 SV=1
Q8D7V4	2.87e-41	18	213	13	212	GlcNAc-binding protein A OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=gbpA PE=3 SV=1
Q5E183	8.61e-41	1	210	1	212	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=gbpA PE=3 SV=1
B5ESR7	8.61e-41	1	210	1	212	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain MJ11) OX=388396 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000262	0.999075	0.000170	0.000179	0.000159	0.000143

TMHMM  Annotations     

start	end
7	29