CAZyme Information: MGYG000002493_01608

Basic Information

• Species: Enterococcus_B pernyi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B pernyi
• CAZyme ID: MGYG000002493_01608
• CAZy Family: GH18
• CAZyme Description: Chitinase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	MGYG000002493_6|CGC2	34215.61	4.5144

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002493	3324684	Isolate	Chile	South America

• Gene Location: Start: 171237; End: 172172 Strand: +

Full Sequence      

MNKKSLLFSVGLLGCLFGGGTDVFAADAADTMPDISNRQVSVGYYHNWVPEQGAGYQGGR
PADTDLAKVNPFYNVIAVSFMKGEGIPTFKPYNMSDTEFRQKVATLNAENRVVIISLGGA
DSHIELHKGEEQAFADEIIRLVEVYGFDGLDIDLEQTAVDAGDNKTVIPDALKIVRAHFE
KEQKHFIISMAPEFPYLRTQGKYVPYITALEQEYDFIAPQLYNQAGDGISVGTEWIAQNN
DSKKFEFLYGISKAFNEGSGGFIQIPANRLALGIPANVDAAANGFVKEPSKVYDVFEQME
KDQTPLKGLMT

Enzyme Prediction     

EC	3.2.1.14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	39	277	1.1e-24	0.6587837837837838

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3469	Chi1	1.26e-129	25	311	13	301	Chitinase [Carbohydrate transport and metabolism].
cd02871	GH18_chitinase_D-like	8.78e-79	39	311	1	292	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
pfam00704	Glyco_hydro_18	4.83e-15	40	284	1	230	Glycosyl hydrolases family 18.
smart00636	Glyco_18	5.82e-12	40	284	1	249	Glyco_18 domain.
cd00598	GH18_chitinase-like	4.26e-11	42	223	2	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBM15482.1	5.78e-225	1	311	1	311
QCJ55698.1	4.72e-224	1	311	1	311
BAO06203.1	1.35e-223	1	311	1	311
AUB51876.1	7.77e-223	1	311	1	311
AZP92242.1	6.34e-222	1	311	1	311

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AXN_A	3.51e-113	25	311	11	299	Hallmarksof processive and non-processive glycoside hydrolases revealed from computational and crystallographic studies of the Serratia marcescens chitinases [Serratia marcescens],4AXN_B Hallmarks of processive and non-processive glycoside hydrolases revealed from computational and crystallographic studies of the Serratia marcescens chitinases [Serratia marcescens]
3IAN_A	4.24e-105	35	311	1	282	ChainA, Chitinase [Lactococcus lactis subsp. lactis]
4W5Z_A	1.79e-94	40	311	32	310	Highresolution crystal structure of catalytic domain of Chitinase 60 from psychrophilic bacteria Moritella marina. [Moritella marina]
4HMC_A	3.78e-92	40	311	10	288	Crystalstructure of cold-adapted chitinase from Moritella marina [Moritella marina],4HMD_A Crystal structure of cold-adapted chitinase from Moritella marina with a reaction intermediate - oxazolinium ion (NGO) [Moritella marina],4HME_A Crystal structure of cold-adapted chitinase from Moritella marina with a reaction product - NAG2 [Moritella marina]
4MB3_A	1.06e-91	40	311	10	288	Crystalstructure of E153Q mutant of cold-adapted chitinase from Moritella marina [Moritella marina],4MB4_A Crystal structure of E153Q mutant of cold-adapted chitinase from Moritella complex with Nag4 [Moritella marina],4MB5_A Crystal structure of E153Q mutant of cold-adapted chitinase from Moritella complex with Nag5 [Moritella marina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q838S2	1.73e-115	25	311	28	319	Chitinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0361 PE=1 SV=1
P27050	1.16e-24	33	285	184	451	Chitinase D OS=Niallia circulans OX=1397 GN=chiD PE=1 SV=4
D4AVJ0	1.66e-12	64	288	15	273	Probable class II chitinase ARB_00204 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00204 PE=1 SV=2
Q05638	6.09e-10	42	286	267	540	Exochitinase 1 OS=Streptomyces olivaceoviridis OX=1921 GN=chi01 PE=1 SV=1
E9F7R6	4.24e-08	39	311	41	324	Endochitinase 4 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chi4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000446	0.990797	0.008040	0.000252	0.000223	0.000189

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002493_01608.