CAZyme Information: MGYG000002493_01609

Basic Information

• Species: Enterococcus_B pernyi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B pernyi
• CAZyme ID: MGYG000002493_01609
• CAZy Family: CBM5
• CAZyme Description: Chitinase A1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
177	MGYG000002493_6|CGC2	19125.76	3.9087

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002493	3324684	Isolate	Chile	South America

• Gene Location: Start: 172440; End: 172973 Strand: +

Full Sequence      

MTASTEYTYTVKAFDAAGNVSEESKALVISTLEEPPADLEAPSVPLNITASSISDKSVSL
SWTQSTDNVGVVGYYVYRDGEQVGETETNTFSDAGLTANTEYSYTVKAFDKAGNISEESK
ALVVTTADAPSAEAWDADTIYDLGDIVTHKGNTYRAKWWTRGNEPGTEQWGPWELIG

Enzyme Prediction     

No EC number prediction in MGYG000002493_01609.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM5	133	173	1.6e-17	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3979	COG3979	2.19e-17	40	173	3	145	Chitodextrinase [Carbohydrate transport and metabolism].
cd12215	ChiC_BD	3.70e-15	134	175	2	42	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.
smart00495	ChtBD3	1.48e-11	132	173	1	41	Chitin-binding domain type 3.
cd00063	FN3	2.80e-09	42	126	1	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	1.47e-08	42	113	1	81	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAO06203.1	4.21e-119	1	177	402	578
BBM15482.1	4.21e-119	1	177	402	578
QCJ55698.1	4.21e-119	1	177	402	578
AUB51876.1	8.73e-116	1	177	402	578
AZP92242.1	9.90e-115	1	177	402	578

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1K85_A	2.16e-18	41	126	3	88	ChainA, CHITINASE A1 [Niallia circulans]
6BT9_A	7.80e-12	38	158	479	608	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
4HMC_A	2.89e-10	84	173	444	527	Crystalstructure of cold-adapted chitinase from Moritella marina [Moritella marina],4HMD_A Crystal structure of cold-adapted chitinase from Moritella marina with a reaction intermediate - oxazolinium ion (NGO) [Moritella marina],4HME_A Crystal structure of cold-adapted chitinase from Moritella marina with a reaction product - NAG2 [Moritella marina]
4MB3_A	2.89e-10	84	173	444	527	Crystalstructure of E153Q mutant of cold-adapted chitinase from Moritella marina [Moritella marina],4MB4_A Crystal structure of E153Q mutant of cold-adapted chitinase from Moritella complex with Nag4 [Moritella marina],4MB5_A Crystal structure of E153Q mutant of cold-adapted chitinase from Moritella complex with Nag5 [Moritella marina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	3.49e-37	1	156	519	677	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P50899	8.60e-30	1	158	854	1020	Exoglucanase B OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cbhB PE=1 SV=1
A0P8X0	8.45e-21	38	126	811	899	Alpha-amylase OS=Niallia circulans OX=1397 GN=igtZ PE=1 SV=1
P50401	3.25e-19	9	162	642	803	Exoglucanase A OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cbhA PE=1 SV=1
P27050	7.19e-19	48	135	99	191	Chitinase D OS=Niallia circulans OX=1397 GN=chiD PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002493_01609.