CAZyme Information: MGYG000002493_01910

Basic Information

• Species: Enterococcus_B pernyi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B pernyi
• CAZyme ID: MGYG000002493_01910
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440	MGYG000002493_8|CGC2	51252.86	9.3681

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002493	3324684	Isolate	Chile	South America

• Gene Location: Start: 94802; End: 96124 Strand: -

Full Sequence      

MELYYLVGLFGIIFGLYVLAKRNNKIKPFFSKLTLAFLVVYLIWRLFYTIPNDGVISLTF
GLILYVAEFIGLFVYGFFIYLFSNKLSKESMRVHYDEEPFQPSVAAFICTYDEDNKLVIA
TALAVKALRYPNKKIYICDDGHREELKELAEKYHIGYLTREGNENAKAGNINYALSQTSS
DLILLLDADFIVKKNIIYEAIDYFRNPKVALIQYPQTFYNKDPFQLLRKSFYNEQELFMR
FLEPALSRENALIHIGTNAIIRCSALEEIGGVPTKSVTEDMATGMLLQNAGYETIFINKA
YALGITPYTARELSSQRTRWAQGTKQIFDHFKPRKFKGLSRMQKLCYYTSYLYWFTSFQK
IIFLLAPTLFMVFDIFIVRSNNNQLLLFFLPPFVMISLSFRLYVPKIRNLTTSHIYDCFV
APIHTRALIKEFFHSEKNSK

Enzyme Prediction     

No EC number prediction in MGYG000002493_01910.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	106	270	4.4e-29	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	2.37e-89	102	328	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	1.77e-61	30	399	184	563	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	4.42e-49	58	411	10	374	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	4.47e-37	111	328	7	232	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
cd06423	CESA_like	5.04e-27	110	280	5	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBM15892.1	1.77e-310	1	440	1	440
BAO06612.1	1.77e-310	1	440	1	440
QCJ56016.1	1.77e-310	1	440	1	440
AUB52314.1	1.68e-308	1	440	1	440
AZP92538.1	2.06e-302	1	440	1	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.48e-46	41	429	213	610	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	1.62e-46	24	429	49	480	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.64e-46	24	429	61	492	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.65e-46	24	429	62	493	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58931	4.11e-51	41	421	99	484	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q8X5L7	4.19e-46	41	429	213	610	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P37653	7.76e-46	41	429	213	610	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
P58932	8.07e-45	11	362	61	419	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
Q9WX61	3.17e-44	21	381	69	434	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999988	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	21
28	50
60	82
351	373
383	405