CAZyme Information: MGYG000002493_02706

Basic Information

• Species: Enterococcus_B pernyi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B pernyi
• CAZyme ID: MGYG000002493_02706
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301	MGYG000002493_15|CGC3	34585.22	6.9712

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002493	3324684	Isolate	Chile	South America

• Gene Location: Start: 80466; End: 81371 Strand: +

Full Sequence      

MKTEIVIDPIPRKADYQTIQAGIAHLSSLPNYVKKTMIIREGVYHEYIECRLSNFQMFGQ
GEVKIVGCRFAKQTLSSGEARETFRTATLFLEGENIRLENIQIINNAGAGEQVGQAVALF
NYAHQVQLINCRLCGQQDTLCTGPLPPIQKDGRPFFTPVLKERKYCRQSYERCWIEGTVD
FIFGGADALFYRCFIHSLVSSSNGYITAASTVKEQERGFLFFRCAIIADYEAPSIYLGRP
WRPYAQVTFEECDVGAHVYQSGWHDWDEKQNRQTARFYEKNNRYQRGICRESWVTVETEV
D

Enzyme Prediction     

No EC number prediction in MGYG000002493_02706.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	13	285	3.5e-67	0.8680555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.49e-45	14	282	92	372	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	3.15e-41	11	279	12	262	pectinesterase
pfam01095	Pectinesterase	2.60e-39	15	268	11	247	Pectinesterase.
PLN02432	PLN02432	1.53e-29	13	294	20	266	putative pectinesterase
PLN02745	PLN02745	3.73e-27	15	283	296	547	Putative pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAO08201.1	8.04e-230	1	301	1	301
QCJ57507.1	1.33e-228	1	301	1	301
AUB53771.1	1.05e-200	1	301	1	301
BBU66736.1	4.80e-121	1	297	1	299
ALZ53106.1	5.14e-121	1	297	3	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.16e-20	15	267	14	249	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1C_A	1.09e-18	74	282	79	261	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.09e-18	74	282	79	261	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	3.89e-16	15	282	18	268	Pectinmethylesterase from Carrot [Daucus carota]
4PMH_A	3.55e-12	86	293	149	353	Thestructure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.77e-31	15	279	16	262	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O48711	6.50e-24	15	282	247	497	Probable pectinesterase/pectinesterase inhibitor 12 OS=Arabidopsis thaliana OX=3702 GN=PME12 PE=2 SV=1
Q8L7Q7	8.54e-23	16	282	301	561	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q43043	1.06e-21	16	283	69	320	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q7Y201	1.32e-21	15	282	311	561	Probable pectinesterase/pectinesterase inhibitor 13 OS=Arabidopsis thaliana OX=3702 GN=PME13 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002493_02706.