CAZyme Information: MGYG000002493_02817

Basic Information

• Species: Enterococcus_B pernyi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B pernyi
• CAZyme ID: MGYG000002493_02817
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		29445.8	3.7088

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002493	3324684	Isolate	Chile	South America

• Gene Location: Start: 39805; End: 40677 Strand: -

Full Sequence      

MKMLKVLAIGVTVGGVALAIQTEKAEAAEWTPRSVEQIKAEISGNEYTIKWGDTLSAISG
ATNISVQKLAEWNSIGNVDVIFEGNKLVFEGNVASVQDQSGNTISQAVINENDKVNPGQP
IGQAPVTDSSNDQGSPAMTVPASPATEDSGSTDAGNTVTPPTGGDNGSTGGGNTVTPPAG
GDNGSTEGGNTVTPPTGGDNGSTGDGNETTPPGEGDNGAGGDNGSEGNETDNIPVNIGNS
GIFAATQEEANAQAYALWAEDKFVEFTRFLINPALNAKGDIIGWTVVFYN

Enzyme Prediction     

No EC number prediction in MGYG000002493_02817.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00257	LysM	4.92e-09	46	88	1	43	Lysin motif.
cd00118	LysM	9.24e-09	47	88	3	44	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	9.56e-08	47	88	1	41	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
PRK13914	PRK13914	1.50e-05	21	210	180	365	invasion associated endopeptidase.
PRK10856	PRK10856	7.36e-04	93	212	143	248	cytoskeleton protein RodZ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZP91625.1	2.52e-138	1	290	1	290
QCJ57886.1	2.52e-138	1	290	1	290
ARO46293.1	1.42e-51	1	123	1	123
AMG51589.1	3.34e-51	1	122	1	124
QSP99569.1	3.53e-51	1	150	1	149

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.999040	0.000170	0.000182	0.000171	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002493_02817.