CAZyme Information: MGYG000002494_00331

Basic Information

• Species: Citrobacter_B koseri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_B; Citrobacter_B koseri
• CAZyme ID: MGYG000002494_00331
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000002494_50|CGC2	35456.76	6.8851

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002494	4844850	Isolate	China	Asia

• Gene Location: Start: 94204; End: 95160 Strand: +

Full Sequence      

MGDTLYLLAACRAIKNKTGASIVMLSQPHFSALARACPHISEVWPVDSLNAEQHQCIQRA
QAQGRLFDFTHWAHALRPRHMIDAFLAQAGLEASAADKHLDLVIPESAHSAVDAFWQQHK
LENAPVLLMHPNIGHPNRTWPQNNWHELAQMWLQTGWQVVFIGSNNNSEAGKSMAEAYPA
GVINAIDRFSALETVALMQRANMLVSCDSGPVMLAAATDIPVVALYSTVAAEHRLPFRYG
EAGWRCMGIDLACSHGPCARLLMNDVIFTTVLKRPFDVPTTQEFANWCVHKTPFRCLRQY
EPAMLYTQMVSFVLSLQE

Enzyme Prediction     

No EC number prediction in MGYG000002494_00331.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	71	240	2.6e-30	0.6622222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.54e-31	1	260	10	257	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	2.62e-19	1	273	12	324	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
TIGR02195	heptsyl_trn_II	1.86e-15	136	258	187	304	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	4.50e-14	123	226	104	209	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10916	PRK10916	1.17e-08	136	226	193	287	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVE60900.1	2.49e-242	1	318	12	329
BCL47310.1	2.49e-242	1	318	12	329
ABV13996.1	2.05e-241	1	318	12	329
AVE67501.1	5.63e-239	1	318	12	329
ASE81570.1	5.63e-239	1	318	12	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.08e-09	77	240	135	296	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	8.59e-07	136	239	193	300	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	2.58e-07	136	236	193	297	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37421	4.65e-07	136	239	193	300	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P37692	2.64e-06	136	239	193	300	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.987137	0.012761	0.000081	0.000020	0.000009	0.000013

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002494_00331.