CAZyme Information: MGYG000002494_00907

Basic Information

• Species: Citrobacter_B koseri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_B; Citrobacter_B koseri
• CAZyme ID: MGYG000002494_00907
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
147	MGYG000002494_50|CGC12	16969.59	8.8349

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002494	4844850	Isolate	China	Asia

• Gene Location: Start: 712549; End: 712992 Strand: +

Full Sequence      

MKRLILLLLMLSQSAFANCWDRAANYYHVDPYLLFAIAQVESGMNPYAVGRNHDGTRDVG
LMQINSSHFSALERRGIDEYRLILEPCTSIMVGASILSDMIKVYGYNWEAVGAYNAGVKK
ENYPQRMIYAHKVWETYQRIKMTTQYK

Enzyme Prediction     

No EC number prediction in MGYG000002494_00907.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	27	144	1.2e-24	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	2.26e-93	12	147	14	149	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	3.08e-53	27	139	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	9.37e-32	20	117	1	95	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	4.99e-23	18	141	21	146	lytic transglycosylase; Provisional
cd00254	LT-like	8.34e-17	31	138	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVE60201.1	1.37e-104	1	147	1	147
BCL47931.1	3.93e-104	1	147	1	147
CDZ83921.1	3.93e-104	1	147	1	147
QCQ72039.1	3.93e-104	1	147	1	147
QEU23203.1	3.93e-104	1	147	1	147

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	1.09e-10	18	102	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	1.78e-46	4	141	6	143	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	1.78e-46	4	141	6	143	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	7.21e-46	4	141	6	143	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q55287	3.44e-32	17	140	18	141	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1
Q07568	1.96e-31	17	140	18	141	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001024	0.996626	0.001675	0.000220	0.000206	0.000209

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002494_00907.