CAZyme Information: MGYG000002494_00908

Basic Information

• Species: Citrobacter_B koseri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_B; Citrobacter_B koseri
• CAZyme ID: MGYG000002494_00908
• CAZy Family: GH19
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606	MGYG000002494_50|CGC12	65959.29	4.4742

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002494	4844850	Isolate	China	Asia

• Gene Location: Start: 713138; End: 714958 Strand: +

Full Sequence      

MSKRTLLSVLIAGACTVPFMAQANTLQASSSEPYTIKASDLAKKEQELTNFPLMASVKET
IQTLDNAQVELIEPGRAANPENVKRVEGIIKASDWEYLFPLRAKEYTYSNFLKAVGKFPA
LCKTYNDGRDSDAICRKELATMFAHFAQETGGHESWRPEAEWRQALVYVREMGWSEGQKG
GYNGECNPSVWQGQTWPCGKDKDGEFLSYFGRGAKQLSYNYNYGPFSEAMYGDVRTLLDK
PELVADTWLNLASAIFFFAYPQPPKPSMLQVIDGTWQPNAHDKANGLVPGFGVTTQIING
GVECGGPTEIAQSQNRIKYYKEFANYLKVPVPADEVLGCANMKQFDEGGAGALKIYWEQD
WGWSSDTPDGKTYACQLVGYQTPFSAFKEGDYTKCVQHFYNVNIINDDGSSTKPDEEPVT
PTPADDTPAPAPVPDETPAEPTTVNHAPVAHIAGPIGAVDAGAQVSLSAEGSTDEDGNKL
TYTWRAQDGQTVSGEDKAVVTFAAPEAATAQQYEVSLTVSDGELSSTTSYLLNVKAKAAT
PSQDDGASGSYPAWSANSKYNAGDIVNNHGKLFQCKPFPYSGWCNTAPAYYEPGAGLAWS
DAWSAL

Enzyme Prediction     

No EC number prediction in MGYG000002494_00908.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	82	339	1.3e-77	0.9956709956709957
CBM73	554	604	5e-24	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00325	chitinase_GH19	2.24e-74	90	339	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	1.08e-41	106	330	25	225	Chitinase class I.
COG3979	COG3979	1.69e-30	72	224	43	181	Chitodextrinase [Carbohydrate transport and metabolism].
PRK13211	PRK13211	7.89e-11	461	606	307	477	N-acetylglucosamine-binding protein GbpA.
pfam18911	PKD_4	6.31e-10	442	522	6	80	PKD domain. This entry is composed of PKD domains found in bacterial surface proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVE61290.1	0.0	1	606	1	606
BCL47932.1	0.0	1	606	19	624
QJI78412.1	0.0	1	606	1	606
ABV13338.1	0.0	1	606	19	624
QYG85283.1	0.0	1	606	1	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V92_A	2.38e-36	106	348	29	245	ChainA, GH19 Chitinase [Ficus microcarpa],7V92_B Chain B, GH19 Chitinase [Ficus microcarpa],7V92_C Chain C, GH19 Chitinase [Ficus microcarpa],7V92_D Chain D, GH19 Chitinase [Ficus microcarpa]
7V91_A	4.19e-35	106	348	29	245	ChainA, GH19 Chitinase [Ficus microcarpa],7V91_B Chain B, GH19 Chitinase [Ficus microcarpa],7V91_C Chain C, GH19 Chitinase [Ficus microcarpa],7V91_D Chain D, GH19 Chitinase [Ficus microcarpa]
2BAA_A	1.31e-33	106	329	29	228	TheRefined Crystal Structure Of An Endochitinase From Hordeum Vulgare L. Seeds To 1.8 Angstroms Resolution [Hordeum vulgare]
4MST_A	1.75e-33	106	348	26	242	CrystalStructure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis],4MST_B Crystal Structure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis]
3CQL_A	8.73e-33	106	345	29	242	CrystalStructure of GH family 19 chitinase from Carica papaya [Carica papaya],3CQL_B Crystal Structure of GH family 19 chitinase from Carica papaya [Carica papaya]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P52404	1.05e-39	106	348	94	310	Endochitinase 2 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB2 PE=2 SV=1
P52403	2.10e-39	106	348	96	312	Endochitinase 1 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB1 PE=2 SV=1
P08252	9.80e-39	106	348	107	323	Endochitinase A OS=Nicotiana tabacum OX=4097 GN=CHN48 PE=1 SV=2
P52405	1.44e-38	106	348	96	312	Endochitinase 3 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB3 PE=2 SV=1
P24091	2.28e-38	106	348	102	318	Endochitinase B OS=Nicotiana tabacum OX=4097 GN=CHN50 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000841	0.919432	0.078462	0.000651	0.000342	0.000254

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002494_00908.