CAZyme Information: MGYG000002494_01823

Basic Information

• Species: Citrobacter_B koseri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_B; Citrobacter_B koseri
• CAZyme ID: MGYG000002494_01823
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242	MGYG000002494_50|CGC19	27072.31	10.5313

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002494	4844850	Isolate	China	Asia

• Gene Location: Start: 1635692; End: 1636420 Strand: -

Full Sequence      

MSKGRFTPLASLRRLLLRILVVLAVFWGGGIALFSVVPVPFSAVMVERQISAWLQGDFGY
VAHSDWAGMDEISPWMGLAVIAAEDQKFLEHWGFDVSAIEKALAHNERNENRIRGASTLS
QQTAKNLFLWDGRSWLRKGLEAGLTVGLETVWSKKRILTVYLNIAEFGDGVFGVEAASQR
YFNKPASRLSMSEAALLAAVLPNPLRFKANAPSGYVRSRQAWILRQMRQLGGESFMTRNH
LY

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	61	228	2.3e-56	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	7.63e-142	26	240	22	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	1.05e-96	31	233	22	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	9.56e-84	31	239	43	252	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.71e-72	60	228	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.50e-47	66	231	4	169	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL50405.1	7.17e-174	1	242	1	242
AVE58098.1	7.17e-174	1	242	1	242
QCQ69929.1	6.88e-172	1	242	1	242
ABV15662.1	6.88e-172	1	242	1	242
ATF99159.1	6.88e-172	1	242	1	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	8.23e-28	66	231	22	187	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	3.20e-27	66	231	22	187	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	6.87e-23	79	231	54	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	1.04e-19	79	204	55	180	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
7U4H_A	1.44e-19	79	207	55	181	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8AQ99	1.38e-172	1	242	1	242	Biosynthetic peptidoglycan transglycosylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=mtgA PE=3 SV=1
B4TWH8	1.63e-155	1	241	1	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella schwarzengrund (strain CVM19633) OX=439843 GN=mtgA PE=3 SV=1
B5F6X7	3.28e-155	1	241	1	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella agona (strain SL483) OX=454166 GN=mtgA PE=3 SV=1
C0PZM1	4.66e-155	1	241	1	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=mtgA PE=3 SV=1
B5RES4	4.66e-155	1	241	1	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998929	0.000199	0.000009	0.000001	0.000001	0.000901

TMHMM  Annotations     

start	end
19	41