CAZyme Information: MGYG000002495_03927

Basic Information

• Species: Citrobacter europaeus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter europaeus
• CAZyme ID: MGYG000002495_03927
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204	MGYG000002495_1|CGC54	22524.62	9.8663

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002495	5258449	Isolate	United States	North America

• Gene Location: Start: 4163669; End: 4164283 Strand: -

Full Sequence      

MNQSQFQQAAGISAGLSARWFPHIDAAMKEFGITAVNDQAMFIAQVGHESAGFTSLVESF
NYSVGGLKKTFGKRLTPYQCEMLGRVDGKQVAHQPQIANLVYGDRMGNNRQGDGWKYRGR
GLIQITGRENYAKCGAALKLDLISTPELLTQEKHAARSAAWYFTLRGCLMYSGDVERVTQ
IINGGQNGINDRRERYAKAKAVLV

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	19	185	7.9e-34	0.5584415584415584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	1.78e-88	1	204	4	205	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	4.86e-09	3	185	3	189	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	1.03e-05	114	163	104	153	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUT97513.1	4.56e-149	1	204	1	204
QPO96160.1	4.91e-144	1	204	1	204
QRQ75281.1	6.98e-144	1	204	1	204
QLN72942.1	2.84e-143	1	204	1	204
QLN72370.1	2.34e-142	1	204	1	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	4.27e-86	1	204	16	223	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
2CJL_A	1.91e-08	2	163	14	138	CrystalStructure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
4IJ4_A	1.28e-07	114	185	90	166	CrystalStructure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
3WH1_A	1.29e-07	114	185	91	167	CrystalStructure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
7F88_A	1.61e-07	109	185	79	158	ChainA, Chitinase A [Gemmabryum coronatum],7F88_B Chain B, Chitinase A [Gemmabryum coronatum],7F88_C Chain C, Chitinase A [Gemmabryum coronatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	5.88e-31	21	204	14	196	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O64203	1.06e-12	8	202	187	360	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002495_03927.