CAZyme Information: MGYG000002496_01663

Basic Information

• Species: Salmonella bongori
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Salmonella; Salmonella bongori
• CAZyme ID: MGYG000002496_01663
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
172	MGYG000002496_7|CGC2	19167.19	10.6871

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002496	4572147	Isolate	Italy	Europe

• Gene Location: Start: 156631; End: 157149 Strand: +

Full Sequence      

MARGPALIMLLPCLALAQPLPEAYLRAAKNYRVPPELLWAVTQTESGANLSGKHRPWPWT
LNIKGTGYRYASREQACQALLAAIRSTSLKRIDVGLGQINIGWHRAYFDSPCDALYPLQN
LSLTAQLLRKRYDERPGSWLNAAARYHRPAGGAPAARYRKLVSRHLQQAAPP

Enzyme Prediction     

No EC number prediction in MGYG000002496_01663.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	2.23e-09	31	168	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16892	LT_VirB1-like	2.03e-05	33	146	9	121	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK13864	PRK13864	0.005	33	132	41	132	type IV secretion system lytic transglycosylase VirB1; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLS22095.1	3.58e-119	1	172	1	172
QLO27090.1	7.23e-119	1	172	1	172
AGR61707.1	1.10e-118	9	172	1	164
AVE73365.1	8.45e-118	1	172	1	172
QRQ73485.1	1.20e-117	1	172	1	172

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000277	0.999076	0.000168	0.000176	0.000154	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002496_01663.