CAZyme Information: MGYG000002496_03697

Basic Information

• Species: Salmonella bongori
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Salmonella; Salmonella bongori
• CAZyme ID: MGYG000002496_03697
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000002496_23|CGC2	43900.94	6.1229

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002496	4572147	Isolate	Italy	Europe

• Gene Location: Start: 46368; End: 47507 Strand: -

Full Sequence      

MKVYPVKHSPLLRQPEHFIARDELKALIQKVTHNLVKIKDETGEFLLRLDDGRVIDTKGW
AGWEWTHGVGLYGMYQYYQQTGDQTMRKIIDDWFADRFAEGATTKNVNTMAPFLTLAYRY
EETRNPAYLPWLETWAEWAMNEMPRTDHGGMQHITLAEENHQQMWDDTLMMTVLPLAKIG
KLLNRAEYVEEATYQFLLHVQNLMDKETGLWFHGWSYEGHHNFANARWARGNSWLTIVIP
DFLELLDLPESSAVRRYLVQVLNAQVAALAHCQDESGLWHTLLDDPHSYLEASATAGFTY
GILKAVRKRYVDRHYAVVAENALRGIVQHISPEGELLQTSFGTGMGHDLDFYRHIPLTSM
PYGQAMAILCLTEYLRNYF

Enzyme Prediction     

No EC number prediction in MGYG000002496_03697.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	60	376	3e-117	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.93e-148	29	379	2	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	9.88e-132	38	378	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCC30822.1	4.93e-293	1	379	1	379
ASG54408.1	4.93e-293	1	379	1	379
QQP76784.1	4.93e-293	1	379	1	379
QUZ60534.1	4.93e-293	1	379	1	379
QGF77023.1	4.93e-293	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	5.83e-271	3	379	5	381	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.82e-242	2	379	5	382	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	3.65e-151	23	378	7	372	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	1.06e-20	164	357	199	392	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4WU0_A	2.83e-19	63	333	23	305	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	3.87e-49	63	377	29	338	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	2.65e-09	165	336	201	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002496_03697.