CAZyme Information: MGYG000002497_02763

Basic Information

• Species: Klebsiella aerogenes
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella; Klebsiella aerogenes
• CAZyme ID: MGYG000002497_02763
• CAZy Family: GT2
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443	MGYG000002497_2|CGC33	50622.56	9.694

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002497	5138968	Isolate	United States	North America

• Gene Location: Start: 2924071; End: 2925402 Strand: +

Full Sequence      

MTDRIIAFSILCLVFGLPLGVAAVFTGELILDFVFFWPLFMSVLWITGGLYFWFQLERHW
PWGKETPPPELAGNPLISILIPCFNEEKNARETIEAALAQRYRNIEVIAINDGSSDDTAR
VLNQLAEEYALLRVIHLAENQGKAVALKAGAAAARGDLLVCIDGDALLDRDTAAYLVAPL
IQYPHVGAVTGNPRIRTRSTLIGRIQVGEFSSIIGLIKRTQRIYGRVFTVSGVIAAFRRQ
ALADVGYWSPDMITEDIDISWKLQLRHWAIFFEPRALCWILMPETLKGLWKQRLRWAQGG
AEVFLVNLRRLFRWEHHRMWPLFLEYALSTLWAFAYAVTIFLFIASHFAPLPENLTVRSL
FPPEFTGLLLGVMCLLQFIASLYIERRYERGVAGSLFWVIWFPMVYWMIGLLTTIVAFPK
VMLKRKRARARWVSPDRGKGRMS

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	77	297	5.2e-39	0.9739130434782609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14583	hmsR	0.0	1	442	1	442	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
TIGR03937	PgaC_IcaA	0.0	30	438	1	407	poly-beta-1,6 N-acetyl-D-glucosamine synthase. Members of this protein family are biofilm-forming enzymes that polymerize N-acetyl-D-glucosamine residues in beta(1,6) linkage. One named members is IcaA (intercellular adhesin protein A), an enzyme that acts (with aid of subunit IcaD) in Polysaccharide Intercellular Adhesin (PIA) biosynthesis in Staphylococcus epidermis). The homologous member in E. coli is designated PgaC. Members are often encoded next to a polysaccharide deacetylase and involved in biofilm formation. Note that chitin, although also made from N-acetylglucosamine, is formed with beta-1,4 linkages.
PRK11204	PRK11204	0.0	21	441	1	420	N-glycosyltransferase; Provisional
COG1215	BcsA	8.80e-67	33	435	14	431	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	3.64e-55	79	256	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBS14241.1	0.0	1	443	1	443
QLS47253.1	0.0	1	443	1	443
AEG96684.1	0.0	1	443	1	443
AKK82276.1	0.0	1	443	1	443
VEI11988.1	0.0	1	443	1	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	2.47e-16	61	307	117	382	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.61e-16	61	307	129	394	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.62e-16	61	307	130	395	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
5HEA_A	6.52e-11	76	182	6	111	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	1.59e-10	75	195	5	124	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75905	2.79e-219	1	438	1	437	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q8XAR5	3.23e-218	1	438	1	437	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
Q5HCN1	7.17e-102	32	438	5	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q9RQP9	7.17e-102	32	438	5	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q6GDD8	7.17e-102	32	438	5	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999353	0.000636	0.000005	0.000005	0.000002	0.000006

TMHMM  Annotations     

start	end
5	27
32	54
323	345
365	384
396	418