CAZyme Information: MGYG000002497_03452

Basic Information

• Species: Klebsiella aerogenes
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella; Klebsiella aerogenes
• CAZyme ID: MGYG000002497_03452
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
691	MGYG000002497_2|CGC46	77406.11	7.2255

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002497	5138968	Isolate	United States	North America

• Gene Location: Start: 3675962; End: 3678037 Strand: +

Full Sequence      

MENKRLDNAALAAGISPSYINAHGQPQSIAAATKQRLLDAMHRTSTAAKAAVEPLPSVKV
FTHGKKMQLPVAGSGAFHWLLTTEEGKQYQGETRGGETLALPGRLPTGYHTLTLTRDGER
WHCRAIVTPARCYEPQALKEGKKLWGACVQLYTLRSENNWGIGDFGDLRAMLPEIARRGG
AFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFQRSPAAQAWWQLAETQQ
ALQAARQTADVDYTAVTALKLTALRLAWAEFSTREDEQMAEFRQFVLREGESLYWQAAFD
ALHAWQSRQDPMRWGWPAWPEAYQSTSSPQVKTFCAEHADEVSFYLWLQWLAYTQFAACW
HTSQQDGMPIGLYRDLAVGVAEGGSETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMD
PHVMVARAYEPFIELLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDDLL
AILALESQRHRCMVIGEDLGTVPVEIVGKLRKSGVYSYKVLYFENGPDKTFRAPKAYPQQ
SMAVATTHDLPTLRGYWESGDLTLGKTLGLYPDEVVLRGLYADREQAKQGLLDALHRHGC
LPKRAGHKASLMAMTSTLNRGMQRYIADSNSALLGLQPEDWLEMASPVNIPGTSTEYPNW
RRKLSVTLEQMFADAQVNKLIKDLDKRRKAR

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	149	686	2.9e-162	0.9898785425101214

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00217	malQ	0.0	131	686	2	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1640	MalQ	0.0	132	691	1	519	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK11052	malQ	0.0	1	690	1	691	4-alpha-glucanotransferase; Provisional
PRK14507	PRK14507	0.0	6	691	8	724	malto-oligosyltrehalose synthase.
pfam02446	Glyco_hydro_77	0.0	149	667	1	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKK82910.1	0.0	1	691	1	691
AML38167.1	0.0	1	691	1	691
ATY05160.1	0.0	1	691	1	691
ATM93516.1	0.0	1	691	1	691
AVE98246.1	0.0	1	691	1	691

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3P_A	0.0	1	687	1	686	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	0.0	2	687	2	686	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]
5B68_A	1.01e-77	87	660	121	673	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
2X1I_A	1.71e-26	251	559	95	405	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
1CWY_A	1.33e-20	251	559	95	405	CrystalStructure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans [Thermus aquaticus],1ESW_A X-Ray Structure Of Acarbose Bound To Amylomaltase From Thermus Aquaticus. Implications For The Synthesis Of Large Cyclic Glucans [Thermus aquaticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15977	0.0	1	690	1	689	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2
P45176	5.77e-166	99	674	105	683	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1
P9WK22	1.09e-88	54	674	68	703	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P65337	1.09e-88	54	674	68	703	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK23	1.09e-88	54	674	68	703	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002497_03452.