CAZyme Information: MGYG000002497_04368

Basic Information

• Species: Klebsiella aerogenes
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella; Klebsiella aerogenes
• CAZyme ID: MGYG000002497_04368
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000002497_2|CGC57	41475.14	5.7099

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002497	5138968	Isolate	United States	North America

• Gene Location: Start: 4617810; End: 4618907 Strand: -

Full Sequence      

MSQKNNRPELQSLIEALIGNLTAITDDSGEYLQRLADGRVVDTKGWDGWEWTHGIALFGL
FRYQQLTGSLRARELIDGWFSARFAEGTPEKNINTACPFLTLALCYQQTPRSDWRAYLES
WGDAIYRQMPRTEEGCLQHVTYENPHHQQIWDDTLMMAVLPLAMLGKMFGKPRWVEEAKF
QFLQHLHYLSDRQSGLWFHGWHFDGRHHFAGALWARGNSWITLAIPELLEMLELDEHDAF
YRQLQNTLQIQVSALARCQAENGLWPTLLNDPDSYLEASATAGFAAGIFKAVRLGYLDDG
FLPVAGKACRGIIEHISPQGELTQVSFGTAMGNDLDHYRNIPLTAMPYGQAMAILCLVEA
LRRTL

Enzyme Prediction     

No EC number prediction in MGYG000002497_04368.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	46	362	2.4e-103	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	8.37e-97	20	363	7	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.56e-92	24	363	2	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKK83761.1	5.22e-281	1	365	1	365
QTK91229.1	3.02e-280	1	365	1	365
VEI08728.1	6.09e-280	1	365	1	365
ATX88888.1	6.09e-280	1	365	1	365
QFI16312.1	6.09e-280	1	365	1	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	1.03e-151	7	363	24	380	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	8.14e-151	7	362	23	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	2.81e-122	9	363	7	371	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	2.52e-14	118	343	170	392	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4CE7_A	3.90e-09	151	312	154	323	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	4.85e-45	49	362	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	2.58e-09	166	297	10	147	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.58e-09	166	297	10	147	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
L7P9J4	2.18e-08	151	312	161	330	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	9.11e-07	151	314	159	331	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002497_04368.