CAZyme Information: MGYG000002497_04753

Basic Information

• Species: Klebsiella aerogenes
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella; Klebsiella aerogenes
• CAZyme ID: MGYG000002497_04753
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
904		100012.58	5.1834

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002497	5138968	Isolate	United States	North America

• Gene Location: Start: 5042625; End: 5045339 Strand: +

Full Sequence      

MRIPTGNFGNVTPQAQQNRVAVSNVGAVGNAISGAGVALGDAADLEQRRQDKADVAATQA
ILTDLEAKSNDRWENPETGATVTRQGFKSSGVVTDMDKADAGDYEEARKRVPPSQLNYFD
AQWKAGQVRRTSTYSGFERAQTEEAQRQQLNATVTSSVEQEASAYDNPMQAGLIRSARKH
SIEMYGQARGWSQERIDGAVSEANQKALEQRAQNYAVTNPTGWLNGDFTLVNSSTGELDM
RAVGLVESGGKHRNADGSLVTSPAGAQGEFQLMPDTGKELAAKRGVEYNPDDPVQHAQLA
RDYAGQLSKKYQSETLAGAAYNWGMGNVDKLIAKVGDPRKGEISMADFVKQLPAETRGWL
SRYNKNKTGLDPVAVNKIDNIAESQIRQQRTALRQQIDPILNNTMAQLYNGEVPDAMPNA
STILFAYGEQGQTAVKQLDIAIDTARTFQAIQYVTPAEQQAELAKVKPQANDPDYALKLD
AYGKLSALVQKSNANIQAQRDSARFNDALISGEKLDPSNKSMQKAADNTPSALNFRINDA
TTHDAIVQQVNQTGIIPSQVTSQLNAIARSSSPDVVKQGSTLFNALYETDPASVGDMPKD
MQSFYLTVKQLTDSGMASDEAVKQAQNVTYNQTDALKSQLSSTQSTKEYRKERDSAMDSA
VSSMKPWYSFGGPAADDQNPDTVKFRNDYQSLYDINYRNSGGNADVAKKMTNTQIARTWS
LSDVNGSTQFMKYAPEALYNYGPSGWQAAQWKEEKERLTYGERGEKIETSPTQLGITSGS
APVITSNTPESRIGGELEITPDVLTTRNGDYAIMVRMKDKDGNESVQPFYDKFGRLMRWK
PSLEDWEPYKKMQQEREQQGEDEISRWKDIRGFKEKHRALDEQYQRLHDDRMNRVKNYFS
WSNE

Enzyme Prediction     

No EC number prediction in MGYG000002497_04753.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	1.19e-14	260	358	38	137	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.61e-14	241	362	5	105	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16894	MltD-like	2.47e-11	239	363	9	124	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd16896	LT_Slt70-like	5.24e-10	242	367	24	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.71e-08	241	338	16	109	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKK84118.1	0.0	1	904	1	904
QIH94054.1	0.0	1	904	1	904
APM30465.1	0.0	1	903	1	903
QXC67614.1	0.0	1	904	1	904
AUW09398.1	0.0	1	904	1	904

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002497_04753.