CAZyme Information: MGYG000002498_00937

Basic Information

• Species: Enterobacter sichuanensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter sichuanensis
• CAZyme ID: MGYG000002498_00937
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
150	MGYG000002498_2|CGC2	17111.73	8.8477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002498	4685711	Isolate	Singapore	Asia

• Gene Location: Start: 121105; End: 121557 Strand: +

Full Sequence      

MKRLLFLLLILSQSALANCWNKAAHYYHVDPYLLYAIANVESGMNPYAVGKNHDGTIDVG
LMQINSTHFTALEQHGISERRLMTEPCTSIMVGASILSGMIKVYGYNWEAVGAYNAGLKK
ENYPKRMVYAHKVWEKYQQLKSVAHERNDW

Enzyme Prediction     

No EC number prediction in MGYG000002498_00937.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	22	143	5.9e-24	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	1.37e-87	12	150	14	152	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	8.18e-52	27	139	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.44e-27	20	118	1	96	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	1.10e-23	18	142	21	147	lytic transglycosylase; Provisional
COG0741	MltE	1.74e-14	20	128	143	251	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ08505.1	9.20e-109	1	150	1	150
QWC68387.1	2.95e-96	1	150	1	150
QMR77356.1	5.96e-96	1	150	1	150
QXM19709.1	8.47e-96	1	150	1	150
BBT89823.1	1.71e-95	1	150	1	150

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	8.30e-11	18	102	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	5.69e-46	9	149	11	151	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	5.69e-46	9	149	11	151	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	2.30e-45	9	149	11	151	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q55287	2.70e-32	1	148	1	149	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1
Q07568	1.09e-31	1	148	1	149	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003225	0.972065	0.023855	0.000285	0.000260	0.000269

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002498_00937.