CAZyme Information: MGYG000002500_03672

Basic Information

• Species: Enterobacter cloacae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cloacae
• CAZyme ID: MGYG000002500_03672
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242	MGYG000002500_2|CGC53	27179.9	9.4742

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002500	5087499	Isolate	not provided	not provided

• Gene Location: Start: 3713132; End: 3713860 Strand: -

Full Sequence      

MNWPQITLIILLAFGLGVTAIKHGEPRNDKYSFWWQLAGNLVIAWLLWCGGFFSQARAAQ
PPQAALQYRDDVIRNARLEWGMSAPVADFAAQLHQESGWRPDAVSPVGAQGLAQFMPATA
DWISQLMPELNSREPFNPAWAIRALVSYDRWLWQRVSAANGCERMAMTLSGYNGGLGWVQ
RDKRLASQQGLDSARWFGHVATVNAGRSAANWRENRHYPQRILRELAPRYLTWGGSSCVE
PG

Enzyme Prediction     

No EC number prediction in MGYG000002500_03672.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	89	224	5.4e-17	0.7407407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381606	cd13403	2.65e-26	90	217	16	137	MLTF-like membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13399	Slt35-like	1.94e-21	85	177	4	96	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	5.55e-18	89	227	4	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	1.45e-17	66	224	2	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	4.32e-15	95	186	21	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASQ19248.1	8.15e-189	1	242	1	242
QLO47525.1	1.11e-186	1	242	1	242
QHC76318.1	1.11e-186	1	242	1	242
QMR45464.1	4.53e-186	1	242	1	242
AMO48461.1	4.53e-186	1	242	1	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	4.11e-07	22	180	413	560	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	3.20e-06	22	180	413	560	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2SK06	5.67e-09	78	197	315	422	Membrane-bound lytic murein transglycosylase F OS=Hahella chejuensis (strain KCTC 2396) OX=349521 GN=mltF PE=3 SV=1
A1S850	4.42e-08	89	196	299	400	Membrane-bound lytic murein transglycosylase F OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=mltF PE=3 SV=2
Q0AQY9	1.41e-07	89	196	307	408	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
A1U3J1	3.57e-07	71	197	292	406	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
A8H256	4.71e-07	89	196	296	397	Membrane-bound lytic murein transglycosylase F OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	21
33	55