CAZyme Information: MGYG000002501_00733

Basic Information

• Species: Enterobacter cloacae_K
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cloacae_K
• CAZyme ID: MGYG000002501_00733
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
758	MGYG000002501_5|CGC4	87473.76	6.629

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002501	4737021	Isolate	France	Europe

• Gene Location: Start: 84686; End: 86962 Strand: +

Full Sequence      

MHIFVLSRSGHIKSRPGALKKDDIKNRMNTMSDRVDRDVINALIAGHFADPFSVLGMHRT
EAGLEVRALLPDATEVWVIEPKTGRKVGNLECLDSRGFFSGVMPRRKNPFRYQLAVLWHG
QQNLIDDPYSFGPLLKEMDAWLLSEGTHLRPYETLGAHADTMDGITGTRFAVWAPNAQRV
SVVGQFNYWDGRRHPMRLRRETGIWELFIPGAHPGQLYKFEMIDANGKLRIKADPYAFEA
QMRPDTASLICGLPEKVVQTEERKQANRFDAPISVYEVHLGSWRRHTDNNFWLSYRELAD
QLVPYAKWMGFTHLELLPVNEHPFDGSWGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGL
NVILDWVPGHFPADDFALAEFDGTKLYEHSDPREGYHQDWNTLIYNYGRREVANYLVGNA
LYWIERFGIDALRVDAVASMIYRDYSRKEGEWIPNEFGGRENLEAIEFLRNTNRIIGEQV
DGAVTMAEESTDFAGVSRPPSLGGLGFWYKWNLGWMHDTLDYMKLDPVHRKYHHDKLTFG
MLYNYTENFMLPLSHDEVVHGKKSILDRMPGDAWQKFANLRAYYGWMFAFPGKKLLFMGN
EFAQGREWNHDASLDWHLLEGGDNWHHGVQRLVRDLNLTYRHHKALHELDFDPYGFEWLV
VDDHERSVFVFVRRDKAGNEIIVASNFTPVPREHYRFGINQPGKWREILNTDSMHYHGSN
AGNGGLVQSDAIESHGRPNSLSLTLPPLGTIWLMREGE

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	304	604	4e-157	0.9966777408637874
CBM48	154	241	4.6e-22	0.9210526315789473

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	132	757	4	629	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	130	755	1	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	0.0	35	753	503	1220	glycogen branching enzyme; Provisional
PRK14706	PRK14706	0.0	149	753	21	619	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	35	758	1	726	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBJ69474.1	0.0	1	758	1	758
BBI97527.1	0.0	1	758	1	758
BBJ60608.1	0.0	1	758	1	758
BBZ89591.1	0.0	1	758	1	758
BBW47968.1	0.0	1	758	1	758

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LPC_A	0.0	147	758	1	612	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
1M7X_A	0.0	142	758	1	617	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
5GR1_A	3.96e-253	27	753	17	771	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQW_A	5.60e-253	27	753	17	771	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR0_A	1.12e-252	27	753	17	771	Crystalstructure of branching enzyme D501A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q32AV3	0.0	31	758	1	728	1,4-alpha-glucan branching enzyme GlgB OS=Shigella dysenteriae serotype 1 (strain Sd197) OX=300267 GN=glgB PE=3 SV=1
Q5PM06	0.0	31	758	1	728	1,4-alpha-glucan branching enzyme GlgB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=glgB PE=3 SV=1
Q57IT8	0.0	31	758	1	728	1,4-alpha-glucan branching enzyme GlgB OS=Salmonella choleraesuis (strain SC-B67) OX=321314 GN=glgB PE=3 SV=1
Q3YW93	0.0	31	758	1	728	1,4-alpha-glucan branching enzyme GlgB OS=Shigella sonnei (strain Ss046) OX=300269 GN=glgB PE=3 SV=1
Q6CZK0	0.0	38	756	6	724	1,4-alpha-glucan branching enzyme GlgB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002501_00733.