CAZyme Information: MGYG000002501_00958

Basic Information

• Species: Enterobacter cloacae_K
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cloacae_K
• CAZyme ID: MGYG000002501_00958
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
150	MGYG000002501_6|CGC3	17249.88	9.6585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002501	4737021	Isolate	France	Europe

• Gene Location: Start: 157029; End: 157481 Strand: +

Full Sequence      

MKTLFLLLLVISHSVFANCWDKAASYYHVDPYLLYAIANVESGMNPNAIGLNHDGTRDVG
LMQINSSHFSDLERKGINEYRLITEPCTSIMVGASILSGMIKIYGYNWEAVGAYNAGLKK
ENFAQRMVYARKVWNKYQKLKRSTRNRYYY

Enzyme Prediction     

No EC number prediction in MGYG000002501_00958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	26	149	1.2e-23	0.9037037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	2.45e-88	1	147	1	149	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	4.43e-52	27	139	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.98e-31	20	135	1	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	2.57e-26	18	143	21	148	lytic transglycosylase; Provisional
cd00254	LT-like	2.83e-15	31	138	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZV05020.1	3.61e-106	1	150	1	150
AVG34311.1	2.97e-105	1	150	1	150
ASD58523.1	1.21e-104	1	150	1	150
AZL62490.1	2.01e-103	1	150	1	150
AKL00737.1	2.85e-103	1	150	1	150

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	1.51e-11	18	102	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	9.31e-45	13	141	15	143	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	9.31e-45	13	141	15	143	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	3.76e-44	13	141	15	143	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q07568	5.88e-34	2	140	3	141	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1
Q55287	1.91e-32	2	140	3	141	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000218	0.999170	0.000154	0.000145	0.000137	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002501_00958.