CAZyme Information: MGYG000002501_02454

Basic Information

• Species: Enterobacter cloacae_K
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cloacae_K
• CAZyme ID: MGYG000002501_02454
• CAZy Family: GH24
• CAZyme Description: Lysozyme RrrD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
169		18449.57	9.7084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002501	4737021	Isolate	France	Europe

• Gene Location: Start: 4217; End: 4726 Strand: -

Full Sequence      

MNSIIKRCSVAGVLALAVLMPDFRLLKTSPEGLALIADLEGCRLSPYRCSAGLWTSGIGH
TANVVPTRDITEREAAVNLVADVLNVERRLAACAPVEMPPRVYDALVSFSFNVGAGAACR
STLVSFIKRKQWSQACGQLTRWVYVNGVKNTGLENRRVREKAWCMKGLP

Enzyme Prediction     

No EC number prediction in MGYG000002501_02454.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	29	160	9.4e-42	0.9854014598540146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16901	lyz_P1	3.11e-66	28	165	2	140	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	1.01e-46	28	169	7	152	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd00737	lyz_endolysin_autolysin	6.80e-45	32	162	1	133	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16900	endolysin_R21-like	1.35e-33	11	165	1	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00959	Phage_lysozyme	4.12e-13	54	157	2	106	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGW88747.1	1.21e-120	1	169	1	169
QIR24517.1	4.93e-120	1	169	1	169
QLC84426.1	2.85e-119	1	169	1	169
AOP97169.1	2.85e-119	1	169	1	169
BBI97203.1	1.16e-118	1	169	1	169

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XJU_A	3.61e-23	27	168	1	154	ChainA, Lysozyme [Punavirus P1],1XJU_B Chain B, Lysozyme [Punavirus P1]
1XJT_A	3.00e-21	27	168	29	182	ChainA, Lysozyme [Punavirus P1]
3HDF_A	1.68e-18	39	167	9	138	ChainA, Lysozyme [Enterobacteria phage P21],3HDF_B Chain B, Lysozyme [Enterobacteria phage P21]
3HDE_A	2.15e-18	26	167	24	163	ChainA, Lysozyme [Enterobacteria phage P21],3HDE_B Chain B, Lysozyme [Enterobacteria phage P21],3HDE_C Chain C, Lysozyme [Enterobacteria phage P21],3HDE_D Chain D, Lysozyme [Enterobacteria phage P21]
4ZPU_A	3.76e-18	26	167	24	163	Thestructure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_B The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_C The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_D The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q37875	3.36e-22	27	168	29	182	SAR-endolysin OS=Escherichia phage P1 OX=2886926 GN=17 PE=1 SV=1
P51728	1.05e-20	27	165	34	184	SAR-endolysin OS=Haemophilus phage HP1 (strain HP1c1) OX=1289570 GN=lys PE=3 SV=1
O80292	2.89e-19	39	167	36	165	SAR-endolysin OS=Bacteriophage PS119 OX=83128 GN=19 PE=3 SV=1
Q9T1T5	1.92e-18	29	162	4	141	Endolysin OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=13 PE=3 SV=1
O80288	2.24e-18	2	167	9	165	SAR-endolysin OS=Bacteriophage PS34 OX=83127 GN=19 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.556877	0.432757	0.007362	0.000915	0.000603	0.001486

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002501_02454.