CAZyme Information: MGYG000002501_02573

Basic Information

• Species: Enterobacter cloacae_K
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cloacae_K
• CAZyme ID: MGYG000002501_02573
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	MGYG000002501_18|CGC1	26711.94	10.3445

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002501	4737021	Isolate	France	Europe

• Gene Location: Start: 116563; End: 117288 Strand: -

Full Sequence      

MSRQSGAGAWVKRILLRIVLVLAVFWGGGLALFSIMPVPFSAVMVERQLGAWLSGDFGYV
AHSDWVSMDEISPLMGLAVIAAEDQKFPEHWGFDVAAIEKALAHNERHENRVRGASTLSQ
QTAKNLFLWDGRSWVRKGLEAGLTLGMETVWSKKRILTVYLNVAEFGDGVFGVEAAAQRY
FNKPASRLSMSEAALLAAVLPNPIRFKASVPSGYVRSRQAWIIRQMNQLGGEGFMQRNNL
M

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	60	227	7.9e-57	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	4.90e-147	9	239	6	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	2.46e-96	10	232	2	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	9.35e-85	8	241	22	255	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.46e-74	59	227	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	2.31e-48	65	230	4	169	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGW88877.1	3.03e-170	1	241	1	241
QIR24645.1	4.30e-170	1	240	1	240
QBN12011.1	1.44e-168	1	241	1	241
BBJ69293.1	1.44e-168	1	241	1	241
AZV07325.1	2.04e-168	1	241	1	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.90e-29	65	230	22	187	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	7.41e-29	65	230	22	187	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	7.89e-24	78	230	54	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	2.90e-20	39	230	20	206	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
3DWK_A	1.70e-19	66	202	30	168	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8AQ99	1.60e-148	9	240	10	241	Biosynthetic peptidoglycan transglycosylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=mtgA PE=3 SV=1
B4TWH8	2.17e-146	2	240	3	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella schwarzengrund (strain CVM19633) OX=439843 GN=mtgA PE=3 SV=1
A9N776	8.84e-146	2	240	3	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) OX=1016998 GN=mtgA PE=3 SV=1
B4T739	1.26e-145	2	240	3	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella newport (strain SL254) OX=423368 GN=mtgA PE=3 SV=1
Q8ZLR7	1.26e-145	2	240	3	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999273	0.000396	0.000008	0.000002	0.000001	0.000363

TMHMM  Annotations     

start	end
13	35