CAZyme Information: MGYG000002501_03261

Basic Information

• Species: Enterobacter cloacae_K
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cloacae_K
• CAZyme ID: MGYG000002501_03261
• CAZy Family: GH0
• CAZyme Description: HTH-type transcriptional activator RhaR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	MGYG000002501_24|CGC1	90895.56	7.2962

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002501	4737021	Isolate	France	Europe

• Gene Location: Start: 40841; End: 43189 Strand: +

Full Sequence      

MEHRGNEFAIAVEDIRLFAQDEGDLLTILWVLEGQAELQTEAGQERVPTNGLVVINRHQR
WRLISQNANVTLRVVLSGRWVIQLYNDFFAHDYAVPEESGGRWPQCDELRHLLRQLLVVT
LVNDPHRYRLEANRWLSEILLLLIGRFQQPVRQKPRNQHANVSKRIARVLERIDASYTRR
ITLAEIAESEFVSEAWLSRLFRKETGASFMQYITALRLEKAADALCLTSRPLHQIALENG
FASTRMMTDSFQRYHNMSPGEFRKAGRHRPLAFRPRTTVDEQRFPVAVDTLFSLLNDAET
RGWEPSPLTYSPCQERILDVQQLYPLSSALRRTRLVITLRELDDLLREDVRRHLEALHEA
IPIEGIDIAEPFLSSRLFATGWDDPQMAGYACWYHLQQLFTWVAKKGWTVLLHTGVTTRC
DLLTRFLQLSVNRFLPDITAGWHVVMHWSPQANEETQEHAWRAQRAALRAYLPQAKFGVW
HRFSPDGSELSGDALFRSDILDEADFLACPADANELLDLAQLDPAHLSSSENYPVLKVRQ
ILAALRQRQRTLPVWLLSWNTLTGNTRATNGWFFRGALLMQNLLGLSEQVWLAGFWLNSG
LQGEARANNTLDTSSLALQYNHGLPRPIYWVLWLWQRLRGEMLVNDKSVLLLRHQGRYQL
LLRNVVVFNPLLSSEEAFIQRFRQQYHLELRGMRGHWRIKRHLFDRHNGALYPLLEEVHS
DSGPDEEMWRWIAHKARPTLSLRDERLYDGWQITESLESNALVLYEFTPLNVRGEEENHS
PR

Enzyme Prediction     

No EC number prediction in MGYG000002501_03261.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3664	XynB	1.38e-24	421	770	85	427	Beta-xylosidase [Carbohydrate transport and metabolism].
smart00342	HTH_ARAC	6.13e-24	180	263	1	84	helix_turn_helix, arabinose operon control protein.
COG2207	AraC	3.71e-23	165	270	21	126	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
COG4977	GlxA	3.44e-17	149	271	207	327	Transcriptional regulator GlxA family, contains an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].
pfam12833	HTH_18	5.67e-17	186	265	1	81	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBT92000.1	0.0	1	782	1	782
QWC66118.1	0.0	1	782	1	782
QXM21979.1	0.0	1	782	1	782
QOV79728.1	0.0	1	782	1	781
QLV60813.1	0.0	1	782	1	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SWI_A	1.33e-11	181	264	23	106	TheC-terminal domain of AraT, a response regulator from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1XS9_A	4.01e-08	159	263	3	113	ChainA, Multiple antibiotic resistance protein marA [Escherichia coli]
1BL0_A	5.11e-08	169	263	16	110	MultipleAntibiotic Resistance Protein (Mara)DNA COMPLEX [Escherichia coli]
1D5Y_A	6.57e-08	181	319	20	152	CrystalStructure Of The E. Coli Rob Transcription Factor In Complex With Dna [Escherichia coli],1D5Y_B Crystal Structure Of The E. Coli Rob Transcription Factor In Complex With Dna [Escherichia coli],1D5Y_C Crystal Structure Of The E. Coli Rob Transcription Factor In Complex With Dna [Escherichia coli],1D5Y_D Crystal Structure Of The E. Coli Rob Transcription Factor In Complex With Dna [Escherichia coli]
3LSG_A	3.32e-07	173	264	11	103	Thecrystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_B The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_C The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_D The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_E The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NYT6	7.70e-42	26	766	23	738	Uncharacterized HTH-type transcriptional regulator MW0077 OS=Staphylococcus aureus (strain MW2) OX=196620 GN=MW0077 PE=4 SV=1
Q6GD21	7.70e-42	26	766	23	738	Uncharacterized HTH-type transcriptional regulator SAS0078 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=SAS0078 PE=4 SV=1
Q5HJR8	1.38e-41	26	766	23	738	Uncharacterized HTH-type transcriptional regulator SACOL0084 OS=Staphylococcus aureus (strain COL) OX=93062 GN=SACOL0084 PE=4 SV=2
Q6GKK1	2.49e-41	26	766	23	738	Uncharacterized HTH-type transcriptional regulator SAR0107 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=SAR0107 PE=4 SV=1
Q7A882	8.04e-41	26	766	23	738	Uncharacterized HTH-type transcriptional regulator SA0097 OS=Staphylococcus aureus (strain N315) OX=158879 GN=SA0097 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002501_03261.