CAZyme Information: MGYG000002503_02541

Basic Information

• Species: Enterobacter ludwigii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter ludwigii
• CAZyme ID: MGYG000002503_02541
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		38565.24	5.1472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002503	4697885	Isolate	Australia	Oceania

• Gene Location: Start: 46428; End: 47474 Strand: +

Full Sequence      

MSTFAVVPANQSADNNAKMIYQWLSGLSERQGKKLISGIFGGYSNIGGVDAFSLQQGKDL
QALTGKFPAIYSADYARGWDACTPGEEASLIDFGCNTDLIDHWKKGGLVAISHHLPNPCF
AGNNPGDGKGALKHPVSNDEFSAILQSGTPSRGRWLAMLDKVAQGLQQLNEKGVTVFYRP
LHEMNGEWFWWGATGENTNDTVRMDLYRRLYQDIFNYFVKTKGLNNLLWVFSPDANRDYK
TSYYPGAEYVDITGLDLYTDNPATVNGYDEMVALNKPFAFAEVGPSTINGQFDYANLVSI
ILQKYPKATMFIPWNNDWSPLKNLNASGAYNNDRVINLGDVWNGSVLS

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	10	339	3.5e-80	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	5.03e-82	10	340	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	2.27e-39	37	344	60	347	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOT42686.1	2.17e-269	1	348	1	348
AWC86872.1	1.25e-268	1	348	1	348
QIN37805.1	3.59e-268	1	348	1	348
QLW25928.1	5.10e-268	1	348	1	348
AVP02000.1	5.10e-268	1	348	1	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EET_A	2.09e-193	1	341	5	345	ChainA, Mannanase KMAN [Klebsiella oxytoca]
2QHA_A	1.32e-123	6	348	3	332	FromStructure to Function: Insights into the Catalytic Substrate Specificity and Thermostability Displayed by Bacillus subtilis mannanase BCman [Bacillus subtilis],2QHA_B From Structure to Function: Insights into the Catalytic Substrate Specificity and Thermostability Displayed by Bacillus subtilis mannanase BCman [Bacillus subtilis]
2WHK_A	2.50e-122	6	348	3	332	Structureof Bacillus subtilis mannanase man26 [Bacillus subtilis]
3CBW_A	4.44e-122	6	348	12	341	ChainA, YdhT protein [Bacillus subtilis],3CBW_B Chain B, YdhT protein [Bacillus subtilis]
6Q75_A	1.43e-31	63	316	67	301	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05512	3.29e-121	6	348	29	358	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P55278	1.88e-117	1	348	22	356	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
P16699	3.25e-95	9	341	35	355	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1
G2Q4H7	9.96e-21	10	341	176	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
A1A278	7.98e-20	53	316	81	360	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002503_02541.