CAZyme Information: MGYG000002504_01252

Basic Information

• Species: Enterobacter hormaechei_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter hormaechei_A
• CAZyme ID: MGYG000002504_01252
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
146	MGYG000002504_3|CGC19	16555.18	9.5238

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002504	5004730	Isolate	United States	North America

• Gene Location: Start: 1184246; End: 1184686 Strand: +

Full Sequence      

MKKLILLLLIISQSALANCWNKAAHYYHVDPYLLYAIANVESGMNPYAVGQNRDGTRDVG
LMQINSSHFTALESRGIDEYRLITEPCTSIMVGASILAGMIRVYGYNWEAVGAYNAGLKK
ENYPQRMKYAHKVWAKYQQLKLAARY

Enzyme Prediction     

No EC number prediction in MGYG000002504_01252.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	22	141	2.1e-24	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	7.44e-85	12	146	14	148	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	1.21e-50	27	139	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	8.39e-28	20	118	1	96	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	2.74e-21	18	141	21	146	lytic transglycosylase; Provisional
cd00254	LT-like	6.37e-14	31	138	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBW30546.1	3.50e-102	1	146	1	146
QIE64446.1	3.50e-102	1	146	1	146
SMF90613.1	3.50e-102	1	146	1	146
QPO46887.1	3.50e-102	1	146	1	146
ARA25723.1	3.50e-102	1	146	1	146

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	2.09e-10	18	102	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	3.73e-43	4	141	6	143	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	3.73e-43	4	141	6	143	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	1.51e-42	4	141	6	143	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q55287	1.89e-31	6	144	7	143	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1
Q07568	7.60e-31	6	144	7	143	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004543	0.947830	0.046700	0.000308	0.000280	0.000295

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002504_01252.