CAZyme Information: MGYG000002504_02294

Basic Information

• Species: Enterobacter hormaechei_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter hormaechei_A
• CAZyme ID: MGYG000002504_02294
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203	MGYG000002504_3|CGC33	22734.22	8.7317

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002504	5004730	Isolate	United States	North America

• Gene Location: Start: 2280712; End: 2281323 Strand: -

Full Sequence      

MKLRWFAFLIVLLAGCSSKHDYQYPPWNPEVPVKRAMQWMPISEQAGKAWGVSPRLITAI
IAVESGGNPTLVSKSNAVGLMQLKASTAGREVYRYMGWKGQPSTSELKNPERNISMGTAY
LSILEHGILKGIDDPEVMQYALVVSYVNGAGALLRTFSSDRKEAIEEINDMDKDEFFEHV
VKNHPSAQAPRYIWKVQKAMDAM

Enzyme Prediction     

No EC number prediction in MGYG000002504_02294.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	38	201	6.3e-17	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15470	emtA	1.20e-153	1	203	1	203	membrane-bound lytic murein transglycosylase EmtA.
cd16893	LT_MltC_MltE	2.04e-84	41	200	1	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	1.44e-58	34	199	187	352	membrane-bound lytic murein transglycosylase MltC.
COG0741	MltE	1.00e-32	1	201	93	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.37e-29	45	168	3	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKK96560.1	4.22e-149	1	203	1	203
AKL51928.1	4.22e-149	1	203	1	203
AKK79246.1	4.22e-149	1	203	1	203
QPO87069.1	4.22e-149	1	203	1	203
ANS17421.1	4.22e-149	1	203	1	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3T36_A	6.00e-107	17	203	17	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
4HJY_A	1.91e-106	17	203	20	206	2.4A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJY_B 2.4 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_A 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_B 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12]
2Y8P_A	1.46e-105	19	203	2	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
6GHY_A	4.19e-105	19	203	2	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	4.19e-105	19	203	2	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4WBE8	1.19e-140	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Enterobacter sp. (strain 638) OX=399742 GN=emtA PE=3 SV=1
A8AFS5	4.59e-129	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=emtA PE=3 SV=1
A7MKC3	3.10e-127	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=emtA PE=3 SV=2
C0Q334	2.44e-124	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=emtA PE=3 SV=1
B5R901	2.44e-124	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000073	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002504_02294.