CAZyme Information: MGYG000002504_04388

Basic Information

• Species: Enterobacter hormaechei_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter hormaechei_A
• CAZyme ID: MGYG000002504_04388
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458	MGYG000002504_3|CGC72	53130.65	5.2936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002504	5004730	Isolate	United States	North America

• Gene Location: Start: 4469775; End: 4471151 Strand: -

Full Sequence      

MKYAFPDNFWWGSASSALQTEGTREGETTWDYWFAREPNRFHNGVGPQHTSTFYQHWKTD
IQLLKQLNHNSFRTSISWARLIPDGIGEVSPDAVDFYNQVIDELNEQGITPFITLFHFDM
PMAMQEIGGWENRDVVDAYARYAQICFELFGDRVLHWFTFNEPIVPVEGGYLYDFHYPNV
VDFRRAATVAYHTVLAHAKAVQAYRAGHYAGEIGIVLNLTPSYPRSRNPADVKAAHIADL
MFNRSFLDPVLRGEYPADLVALLKSYDQLPACKPEDGFLIAEGKIDLLGVNYYQPRRVKC
RDSAVNPQAPFMPEWFFDNYEMPGRKMNPYRGWEIYAPGIYDILVNLRDNYGNPRCFISE
NGMGVENEQRFIENGQINDQYRIDFISEHLSWLHKGISEGCNCLGYHMWTFIDNWSWCNA
YKNRYGFIQLDVETQQRTIKKSGEWFAATALNNSFDKE

Enzyme Prediction     

EC	3.2.1.21	3.2.1.85	3.2.1.86

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	453	1.8e-144	0.993006993006993

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	2	458	1	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	1.55e-146	1	455	1	453	Glycosyl hydrolase family 1.
PRK13511	PRK13511	7.98e-112	1	450	1	463	6-phospho-beta-galactosidase; Provisional
PRK09589	celA	9.43e-65	5	453	4	472	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	1.97e-62	2	456	1	472	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKK98491.1	0.0	1	458	1	458
QFI20182.1	0.0	1	458	1	458
AIE61938.1	0.0	1	458	1	458
AWV73909.1	0.0	1	458	1	458
QPO84734.1	0.0	1	458	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	1.63e-161	4	453	2	459	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	9.64e-161	4	453	3	460	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAV_A	1.17e-145	5	455	20	477	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAQ_A	1.66e-145	5	455	20	477	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	5.03e-124	5	458	11	453	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	1.08e-221	2	455	6	465	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
Q08638	1.66e-101	5	456	6	445	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
P26208	2.21e-99	2	455	3	448	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
B9K7M5	7.79e-99	5	453	4	440	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
P0C946	3.06e-93	5	437	4	424	1,4-beta-D-glucan glucohydrolase (Fragment) OS=Thermotoga neapolitana OX=2337 GN=bglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002504_04388.