CAZyme Information: MGYG000002506_02243

Basic Information

• Species: Escherichia coli_D
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia coli_D
• CAZyme ID: MGYG000002506_02243
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240	MGYG000002506_1|CGC24	26995.6	9.1191

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002506	5339468	Isolate	not provided	not provided

• Gene Location: Start: 2274316; End: 2275038 Strand: +

Full Sequence      

MNWPQITLIILFAFGLGVTAIRHGEPRNDKYSFWWQLAGNLVIVWLLWCGGFFSQARAAQ
PPQAALQYRDDVIRNARLEWGLSAPVADFAAQLHQESGWRPDAVSPAGAQGLAQFMPATA
DWISQLMPGLNSREPFNPAWAIRALVSYDRWLWQRVSAASDCERMAMTLSGYNGGLGWVQ
RDRQLASQKGLDSTRWFGHVATVNAGRNAASWRENRHYPQRILHELAPRYLTWGGGSCVD

Enzyme Prediction     

No EC number prediction in MGYG000002506_02243.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	89	224	3.1e-17	0.7407407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	8.68e-28	90	203	16	123	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13399	Slt35-like	1.34e-22	85	186	4	106	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd16896	LT_Slt70-like	2.06e-18	66	224	2	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	4.60e-18	89	223	4	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	3.51e-17	78	227	282	436	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF61725.1	4.88e-185	1	239	1	239
ALD40826.1	1.63e-183	1	239	1	239
QJG64346.1	1.63e-183	1	239	1	239
ARJ95637.1	2.16e-183	1	240	1	240
QLV17406.1	2.16e-183	1	240	1	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	5.36e-07	25	180	416	560	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	4.18e-06	25	180	416	560	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2SK06	1.24e-09	78	197	315	422	Membrane-bound lytic murein transglycosylase F OS=Hahella chejuensis (strain KCTC 2396) OX=349521 GN=mltF PE=3 SV=1
A1U3J1	1.66e-09	71	197	292	406	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
A1S850	3.98e-09	89	196	299	400	Membrane-bound lytic murein transglycosylase F OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=mltF PE=3 SV=2
B0TLJ6	9.67e-09	89	196	296	397	Membrane-bound lytic murein transglycosylase F OS=Shewanella halifaxensis (strain HAW-EB4) OX=458817 GN=mltF PE=3 SV=1
A8H256	1.76e-08	89	196	296	397	Membrane-bound lytic murein transglycosylase F OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	24
31	53