CAZyme Information: MGYG000002506_02434

Basic Information

• Species: Escherichia coli_D
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia coli_D
• CAZyme ID: MGYG000002506_02434
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
167		19270.81	10.4225

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002506	5339468	Isolate	not provided	not provided

• Gene Location: Start: 2465687; End: 2466190 Strand: +

Full Sequence      

MRLPKVKILSIFMFSILITKMSFASSACFNEAGSIFRIEPNLIKAIALVESNLKNDSIGK
NRDKKNNIKSFDYGLMQINQMHIPMLKKRGIIKDERDLLDNPCLNIKIGTEILYNHFSRC
GVTWQCLGTYNAGFAMENQKKRLQYAKKIYVVYTRLNEIDKRKALAK

Enzyme Prediction     

No EC number prediction in MGYG000002506_02434.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	9.92e-46	36	155	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	2.50e-36	12	163	5	149	type III secretion system invasion protein IagB.
pfam01464	SLT	2.35e-29	29	151	1	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	1.63e-21	25	154	19	143	lytic transglycosylase; Provisional
COG0741	MltE	3.79e-13	29	133	143	240	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJF83217.1	3.21e-115	1	167	1	167
QHS40450.1	3.21e-115	1	167	1	167
AIX64695.1	3.21e-115	1	167	1	167
QDB94634.1	3.21e-115	1	167	1	167
AOM71227.1	3.21e-115	1	167	1	167

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	4.74e-10	28	113	3	82	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X6H3	3.16e-107	1	167	1	167	Peptidoglycan-binding-like protein OS=Escherichia coli O157:H7 OX=83334 GN=pbl PE=3 SV=1
Q46790	1.58e-89	1	153	1	152	Putative peptidoglycan-binding-like protein OS=Escherichia coli (strain K12) OX=83333 GN=pbl PE=5 SV=2
P43018	2.48e-25	12	160	5	146	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
E1WAC2	2.77e-24	12	156	5	142	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	2.77e-24	12	156	5	142	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003131	0.994878	0.001379	0.000197	0.000187	0.000203

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002506_02434.