CAZyme Information: MGYG000002506_02583

Basic Information

• Species: Escherichia coli_D
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia coli_D
• CAZyme ID: MGYG000002506_02583
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000002506_1|CGC26	75703.29	8.6728

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002506	5339468	Isolate	not provided	not provided

• Gene Location: Start: 2620873; End: 2622900 Strand: +

Full Sequence      

MIGIFSSGIWRIPHLEKFLAQPCQKLSLLRPVPQEVDAIAVWGHRPSAAKPVAIAKAAGK
PVIRLEDGFVRSLDLGVNGEPPLSLVVDDCGIYYDASKPSALEKLVQDKAGNTALISLAR
EAMHTIVTGDLSKYNLAPAFVADESERSDIVLVVDQTFNDMSVTYGNAGPHEFAAMLEAA
MAENPQAEIWVKVHPDVLEGKKTGYFADLRATQRVRLIAENVSPQSLLRHVSRVYVVTSQ
YGFEALLAGKPVTCFGQPWYAGWGLTDDRHPQSALLSARRGSATLEELFAAAYLRYCRYI
DPQTGEVSDLFTVLQWLQLQRRHLQQRNGYLWAPGLTLWKSAILKPFLRTATNQLSFSRR
CTAASACVVWGVKGEQQWRAEAQRKSLPLWRMEDGFLRSSGLGSDLLPPLSLVLDKRGIY
YDATRPSDLEVLINHSQLTLAQQMRAEKLRQRLVESKLSKYNLGADFSLPAEAKDKKVIL
VPGQVEDDASIKTGTVSIKSNLELLRTVRERNPHAYIIYKPHPDVLVGNRKGNIPTELIA
ELADYQALDADIIQCIQRADEVHTMTSLSGFEALLHGKQVHCYGLPFYAGWGLTVDEHHC
PRREQKLTLADLIYQALIVYPTYIHPTRLQPITVEEAAEYLIQTPRKPMFIRKNNIYRVI
NIYRKLIMFCKVRLG

Enzyme Prediction     

No EC number prediction in MGYG000002506_02583.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	279	649	1.4e-148	0.7086466165413534
GT107	9	314	7.5e-109	0.5770676691729323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	4	648	6	646	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16439	beta_Kdo_transferase_KpsC_2	1.57e-163	368	623	4	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	2.52e-157	367	623	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	1.00e-143	39	299	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16440	beta_Kdo_transferase_KpsC_1	3.90e-140	39	302	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJF83039.1	0.0	1	675	1	675
QJS60170.1	0.0	1	675	1	675
QDM72101.1	0.0	1	675	1	675
QDM85500.1	0.0	1	675	1	675
QJG09224.1	0.0	1	675	1	675

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGC_A	5.47e-251	2	354	3	355	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGB_A	1.50e-73	2	317	11	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	1.80e-73	337	642	10	319	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42217	0.0	1	675	1	675	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
Q05013	8.31e-205	6	658	28	686	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P57037	2.36e-204	6	658	28	686	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
P31858	1.89e-57	335	623	80	381	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002506_02583.