CAZyme Information: MGYG000002506_03282

Basic Information

• Species: Escherichia coli_D
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia coli_D
• CAZyme ID: MGYG000002506_03282
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	MGYG000002506_1|CGC37	40182.57	7.5037

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002506	5339468	Isolate	not provided	not provided

• Gene Location: Start: 3357593; End: 3358663 Strand: -

Full Sequence      

MEKPFRKILVIKMRYHGDMLLTTPVISTLKQNYPDAKIDMLLYQDTIPILSENPEINALY
GISNKGAGTFDKIKNALSLIKTLRANDYDLVINLTDQWMVALLVRCLPARMKISQLYGHR
QHGIWKKSFTHLAPIHGTHIVERNLSVLEPLGITDFYTETTMSYADDCWKKMRQELDALG
VKDHYVVIQPTARQLFKCWDNDKFSMVIDALQHRGYQVVLTCGPSADDLACVDEIARGCQ
IKPITGLAGKTRFPELGALIDHAVLFIGVDSAPGHIAAAVKTPVISLFGATDHVFWRPWT
ENIIQFWAGNYQKMPTRHELDRNKKYLSVIPAEDVIAATEKLLPEDAPSADRNAQL

Enzyme Prediction     

No EC number prediction in MGYG000002506_03282.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	78	304	7.7e-51	0.8755555555555555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10422	PRK10422	0.0	1	352	1	352	lipopolysaccharide core biosynthesis protein; Provisional
TIGR02201	heptsyl_trn_III	1.68e-172	7	344	1	344	lipopolysaccharide heptosyltransferase III, putative. This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	1.73e-99	77	327	2	247	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
COG0859	RfaF	4.58e-95	6	346	2	333	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	5.35e-61	7	341	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJF82381.1	8.19e-269	1	356	1	356
QKD63499.1	1.58e-266	1	356	1	356
QCZ30476.1	6.45e-266	1	356	1	356
VED16238.1	9.17e-266	1	356	1	356
AQV35048.1	9.17e-266	1	356	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	2.16e-23	2	345	5	347	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
2GT1_A	2.39e-07	7	292	2	283	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	2.39e-07	7	292	2	283	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	2.46e-07	7	292	2	283	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
1PSW_A	4.55e-06	7	298	2	297	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	2.60e-254	13	356	1	344	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	1.38e-179	13	344	1	332	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P45042	1.81e-09	8	298	3	297	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37421	1.41e-07	7	346	2	346	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P37692	3.35e-07	7	298	2	297	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002506_03282.