CAZyme Information: MGYG000002507_01616

Basic Information

• Species: Escherichia albertii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia albertii
• CAZyme ID: MGYG000002507_01616
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		38069.81	8.1224

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002507	4965177	Isolate	Gambia	Africa

• Gene Location: Start: 114617; End: 115597 Strand: +

Full Sequence      

MLNLKNFVAKKQNLFQREIPNIKALHIALCFDRGFIMPAGVALYSIISNNSNINLHFHLL
VSGISESECSVFSELERANTSISVYHVTDKFDINPDTLVLGIPLSTCLRFLIPEVVDEKI
TNILYLDSDIICNGSLYDLVDYDLNDYIACVVSDSPDMQERVKKLNYGIDFINYFNAGVM
LINTNAWKEENITQKALEMINNGKVYRYADQDVLNILLNGRLYYLDKKYNNKTTLSVVCD
EEQKNLSNTIIMHYVTQNKPWYKIFRARNFEHYFYNSPWKNYKRMLAPSSSDIRLRAKVY
WSERKYWKATSCYYHYLLAKLFGVKF

Enzyme Prediction     

No EC number prediction in MGYG000002507_01616.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	22	263	5.9e-54	0.8871595330739299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	4.20e-58	25	263	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
PRK15171	PRK15171	9.06e-50	25	322	26	334	lipopolysaccharide 3-alpha-galactosyltransferase.
COG1442	RfaJ	1.86e-43	25	288	3	275	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	5.26e-39	26	264	1	251	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd02537	GT8_Glycogenin	1.38e-10	123	285	93	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTA27685.1	7.57e-243	1	326	1	326
BAT41373.1	7.57e-243	1	326	1	326
AUS67554.1	2.17e-242	1	326	1	326
BAT37071.1	2.17e-242	1	326	1	326
QCT87669.1	6.19e-217	1	325	1	325

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1G9R_A	4.74e-18	27	263	3	254	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
1SS9_A	8.86e-18	25	263	1	254	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
5GVW_A	4.77e-14	32	261	13	235	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVV_A	3.79e-13	32	261	13	235	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
6U4B_A	1.30e-11	24	291	301	602	ChainA, WbbM protein [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19817	1.68e-36	25	322	26	334	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P27129	3.54e-35	18	298	21	312	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P27128	1.96e-33	18	321	23	337	Lipopolysaccharide 1,3-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaI PE=3 SV=1
P19816	1.38e-32	26	321	29	335	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4
P43974	2.88e-23	23	263	37	280	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002507_01616.