CAZyme Information: MGYG000002507_03552

Basic Information

• Species: Escherichia albertii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia albertii
• CAZyme ID: MGYG000002507_03552
• CAZy Family: GH104
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
158	MGYG000002507_28|CGC1	17754.96	8.0268

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002507	4965177	Isolate	Gambia	Africa

• Gene Location: Start: 3044; End: 3520 Strand: -

Full Sequence      

MQTLNSQRKAFLDMVAWSEGTDNGRQPTRNHGYDVIVGGELFTDYSDHPRKLVTLNPKLK
STAAGRYQLLSRWWDAYRKQLGLKDFSPESQDAVALQQIKERGALPMIDRGDIRQAIDRC
SNIWASLPGAGYGQYEHKIGDLISRFKDAGGVVNEADL

Enzyme Prediction     

EC	4.2.2.N1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH104	5	149	1.9e-63	0.9724137931034482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4678	COG4678	1.08e-79	7	153	29	178	Muramidase (phage lambda lysozyme) [Cell wall/membrane/envelope biogenesis, Mobilome: prophages, transposons].
cd00736	lambda_lys-like	3.09e-78	7	151	2	141	Bacteriophage lambda lysozyme and similar proteins. Lysozyme from bacteriophage lambda hydrolyzes the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc), as do other lysozymes. However, unlike other lysozymes, bacteriophage lambda does not produce a reducing end upon cleavage of the peptidoglycan, but rather uses the 6-OH of the same MurNAc residue to produce a 1,6-anhydromuramic acid terminal residue and is therefore a lytic transglycosylase. An identical 1,6-anhydro bond is formed in bacterial peptidoglycans by the action of the lytic transglycosylases of E. coli, though they differ structurally.
pfam00959	Phage_lysozyme	5.78e-27	33	138	1	105	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.
cd00442	Lyz-like	6.24e-06	55	98	16	59	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRA82525.1	8.04e-116	1	158	1	158
CAQ99488.1	8.04e-116	1	158	1	158
QQB97195.1	8.04e-116	1	158	1	158
QDK76800.1	8.04e-116	1	158	1	158
QRB39226.1	8.04e-116	1	158	1	158

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1D9U_A	2.26e-102	1	153	1	153	ChainA, Bacteriophage Lambda Lysozyme [Lambdavirus lambda],1D9U_B Chain B, Bacteriophage Lambda Lysozyme [Lambdavirus lambda],3D3D_A Chain A, Lysozyme [Lambdavirus lambda],3D3D_B Chain B, Lysozyme [Lambdavirus lambda]
1AM7_A	1.14e-96	1	158	1	158	ChainA, LYSOZYME [Lambdavirus lambda],1AM7_B Chain B, LYSOZYME [Lambdavirus lambda],1AM7_C Chain C, LYSOZYME [Lambdavirus lambda]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P03706	2.99e-103	1	158	1	158	Endolysin OS=Escherichia phage lambda OX=10710 GN=R PE=1 SV=1
P51771	1.66e-48	1	152	1	163	Endolysin OS=Escherichia phage P2 OX=10679 GN=K PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002507_03552.