CAZyme Information: MGYG000002508_03884

Basic Information

• Species: Hafnia alvei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Hafnia; Hafnia alvei
• CAZyme ID: MGYG000002508_03884
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	MGYG000002508_1|CGC38	44167.07	6.8298

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002508	4498956	Isolate	South Korea	Asia

• Gene Location: Start: 4267071; End: 4268255 Strand: -

Full Sequence      

MMFRFFTQSPCVGGRHEPRFSAVALCLLLLSFCTQAAASCDWPEWQQFKQHYISEQGRVI
DTSSPKKITTSEGQSYGLFFALVANDRPTFENILQWTQNNLAQGDLSARLPAWLWGMKEK
DKNGKQEWGVLDTNSASDSDLWIAYSLMEAGRLWKVRSYQSLGVLLLQRIAREEVAELPG
FGEMLLPGRVGFAHSPVWTVNPSYLPPQLMARMAGFHGPWAALHKNNQRLLLESSPKGFV
PDWIDWRKDKGWEPTPDKPNVSGYDAIRVYLWAGMMADNDPNKAALIKQWQPMAAMTAEL
GYPPEKVDVATGKASGYGNSGFSAALLPFLAGSDAQAVQRQRVQDNPLGDDAYYSYVLTL
FGQGWDQQRFRFNLKGELLPHWDSSTCASTATSH

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	42	365	2.5e-96	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	0.0	19	390	4	375	cellulase.
COG3405	BcsZ	2.66e-125	27	375	12	353	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	1.99e-91	39	367	1	320	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANC42687.1	1.19e-305	2	394	1	393
AMO83800.1	3.15e-301	2	394	1	393
QIP58234.1	2.31e-286	25	394	1	370
AWV47009.1	2.31e-286	25	394	1	370
AIU75001.1	2.22e-284	25	394	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QXQ_A	1.65e-168	39	394	1	350	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
3QXF_A	3.42e-163	39	394	1	350	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]
7F81_A	1.98e-161	39	390	5	350	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	3.25e-160	39	390	5	350	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
4Q2B_A	6.21e-123	42	388	4	348	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L9	2.27e-171	21	390	6	367	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	1.86e-170	21	390	6	367	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
Q8ZLB7	3.08e-162	27	389	11	368	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8Z289	3.56e-161	27	389	11	368	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
P58935	1.98e-106	28	390	18	383	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.042430	0.927685	0.028925	0.000404	0.000259	0.000273

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002508_03884.