CAZyme Information: MGYG000002510_04231

Basic Information

• Species: Klebsiella quasipneumoniae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella; Klebsiella quasipneumoniae
• CAZyme ID: MGYG000002510_04231
• CAZy Family: GH91
• CAZyme Description: Inulin fructotransferase [DFA-I-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457	MGYG000002510_15|CGC1	49680.79	5.9151

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002510	5247162	Isolate	Australia	Oceania

• Gene Location: Start: 54744; End: 56117 Strand: -

Full Sequence      

MTHDNYYDVTQWHIGNPNKDIGEVINSIILDIKKRQTATDINNGGKPGAIIYIPPGDYHL
KTQVLIDISYLKIMGAGHGFVSSSIRFNTPADDWANLHDIWPGGSRILVDICAHPRDEEH
AGAAFYVKRSGAPRISSVAFENFCIDGLHFIDDGLGKNDPENSYTNGKTGIYIASAQDAF
RITGMGFIYLEHGLTTYNSDAMAIHNNFIAECGNCIELRGAGQASKITDNLIGAGYKGYS
IYAQNFGGLLISGNNIFPRGASSVHLSGVVRSTVTGNRLHSFYPGMLVLENNCAENLIAA
NHFFRDREPWPPMQAYDNGLDDAYGLLHINGSHNSVIANHISETIDIQYLRPQGTKPVII
RLVSGKGNYLANNHIVATTEASAQQAQSSEEDACFAAQVSALLMTDRLKALDAVAVLVEK
ASSLNTILDCGNSQQVMMDRATNAFRATPAPGNIEME

Enzyme Prediction     

EC	4.2.2.18	4.2.2.17	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH91	4	449	1.3e-195	0.9949367088607595

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd21111	IFTase	0.0	5	449	3	395	inulin fructotransferase. Inulin fructotransferase (IFTase; EC 4.2.2.17 and EC 4.2.2.18), a member of the glycoside hydrolase family 91, catalyzes depolymerization of beta-2,1-fructans inulin by successively removing the terminal difructosaccharide units as cyclic anhydrides via intramolecular fructosyl transfer. As a result, IFTase produces DFA-I (alpha-D-fructofuranose-beta-D-fructofuranose 2',1:2,1'-dianhydride) and DFA-III (alpha-D-fructofuranose-beta-D-fructofuranose 2',1:2,3'-dianhydride).
pfam05048	NosD	1.58e-05	162	324	35	188	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QER56622.1	0.0	1	457	1	457
QYD21448.1	0.0	1	457	1	457
QSI15015.1	0.0	1	457	1	457
BBS49629.1	0.0	1	457	1	457
BBK14751.1	0.0	1	457	1	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZKS_A	1.33e-210	1	452	1	444	Crystalstructure of DFA-IIIase from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZKU_A Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_B Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_C Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_D Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_E Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_F Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKW_A Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_B Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_C Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_D Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_E Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_F Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6]
5ZL5_A	3.10e-209	1	452	1	444	Crystalstructure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_B Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_C Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_D Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_E Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_F Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZLA_A Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_B Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_C Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_D Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_E Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_F Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6]
5ZKY_A	4.09e-201	1	452	1	419	Crystalstructure of DFA-IIIase from Arthrobacter chlorophenolicus A6 without its lid [Pseudarthrobacter chlorophenolicus A6],5ZL4_A Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 wihout its lid in complex with GF2 [Pseudarthrobacter chlorophenolicus A6]
2INU_A	1.62e-112	5	376	13	369	Crystalstructure of Inulin fructotransferase in the absence of substrate [Bacillus sp. snu-7],2INU_B Crystal structure of Inulin fructotransferase in the absence of substrate [Bacillus sp. snu-7],2INU_C Crystal structure of Inulin fructotransferase in the absence of substrate [Bacillus sp. snu-7],2INV_A Crystal structure of Inulin fructotransferase in the presence of di-fructose [Bacillus sp. snu-7],2INV_B Crystal structure of Inulin fructotransferase in the presence of di-fructose [Bacillus sp. snu-7],2INV_C Crystal structure of Inulin fructotransferase in the presence of di-fructose [Bacillus sp. snu-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19870	3.96e-91	7	381	6	358	Inulin fructotransferase [DFA-I-forming] OS=Arthrobacter globiformis OX=1665 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000045	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002510_04231.